KEGG   Burkholderia phytofirmans: Bphyt_1393Help
Entry
Bphyt_1393        CDS       T00765                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpy  Burkholderia phytofirmans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bphyt_1393
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bphyt_1393
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bphyt_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1560127..1560924
Genome map
AA seq 265 aa AA seqDB search
MSSTNTNLNGKVAVVTGAASGIGKQIALTLSAAGAAVAIADLNQDGANAVAEEIKKAGGK
AIGVAMDVTSEDAVNQGIDKVAAELGSVDILISNAGIQIVNPIENYSFSDWKKMQAIHVD
GAFLTTKAALKHMYKDDRGGIVIYMGSVHSHEASPLKSAYVTAKHALLGLARVLAKEGAK
HNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEDVIKRVMLGGTVDGVFTTVEDVAQTV
LFLSTFPTAALTGQSFIVSHGWYMQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaacgaacacgaatctgaatggcaaggttgcggttgttacgggcgccgcaagc
ggcatcggcaagcagattgcgctgactctttccgcagcaggcgcggctgtcgcgatcgcc
gacctgaatcaggacggcgcgaacgctgtcgctgaagaaatcaaaaaggccggcggcaag
gcaatcggcgtggcgatggacgtcacgagcgaagacgccgtcaatcagggcatcgacaaa
gtggccgcggaactcggctcggtggatatcctcatttccaacgccggcatccagatcgtc
aatccgatcgaaaactattcgttttcggattggaagaagatgcaggcaatccacgtggac
ggcgcgttcctgaccaccaaggccgcgctcaagcacatgtacaaggacgatcgcggcggc
atcgtgatctacatgggctcggtccactcgcacgaagcgtcgccgctcaaatcggcctat
gtgacggccaagcacgcgctgctgggtctcgcgcgcgtgctggctaaagaaggcgcgaag
cacaacgtgcgctcgcatgtcgtgtgtccgggtttcgtgcgcacgccgctcgtcgacaag
cagattcccgagcaggccaaggaactgggcatcagcgaggaagacgtgatcaagcgcgtc
atgctgggcggcacggtcgacggtgtcttcaccacggtggaagacgtcgcgcaaacggtg
ctgttcctgtccacgttcccgacggcggcgctgaccggccagtcctttattgtgagccac
ggctggtacatgcaataa

DBGET integrated database retrieval system