KEGG   Burkholderia phytofirmans: Bphyt_1467Help
Entry
Bphyt_1467        CDS       T00765                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpy  Burkholderia phytofirmans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bphyt_1467
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphyt_1467
   00650 Butanoate metabolism
    Bphyt_1467
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bphyt_1467
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bphyt_1467
   00622 Xylene degradation
    Bphyt_1467
   00621 Dioxin degradation
    Bphyt_1467
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bphyt_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1645472..1646416
Genome map
AA seq 314 aa AA seqDB search
MYDKQDKQAVAIIGSGNIGTDLMIKVLRDAKHLEMGAMVGIDPASDGLARAKRLGVATTA
HGIEGLVTMPNFGAIRIAFDATSAGAHHRHAAVLREHGVTVIDLTPAAIGPFVVPVVNLF
AHLDAPNLNMVTCGGQATIPIVHAVSRVAPVRYAEIVASIASRSAGPGTRANIDEFTETT
SKAIETVGGAARGKAIIVLNPAEPPLMMRDTVYCLTEEEADTDEIESSIRAMVSAVASYV
PGYRLKQAVQFDRYTAANPLALHANERRAGLKVSVFLEVEGAAHYLPSYAGNLDIMTSAA
LAAAEQIAASRVAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacaaacaggacaagcaggccgtggccatcatcggctccggcaatatcggcacc
gatttaatgatcaaggtgttgcgcgacgcaaagcacctcgaaatgggcgcgatggtcggc
atcgacccggcttcggacggtctcgcgcgcgccaaacggctcggtgtggcgacgaccgcg
cacggcatcgaaggcctcgtcaccatgccgaatttcggcgcgattcgcatcgcgttcgat
gcaacctcggcgggcgcgcatcatcggcatgccgccgtgctgcgcgaacacggcgtgacc
gtgatcgatctgacgccggccgcgatcgggccgttcgtcgtgccggtcgtgaatctgttc
gcgcatctcgacgcgccgaacctgaacatggtgacgtgcggtggccaggcgaccatcccg
atcgtgcacgcggtctcgcgcgtcgcgccggtgcggtacgcggaaatcgtcgcctcgatc
gcaagccgttcggcggggccgggcacgcgcgccaatatcgacgagttcaccgaaacgacc
tcgaaggcgatcgaaaccgtaggcggcgcggcgcgcggcaaggccatcatcgtgttgaac
ccggccgagccgccgttgatgatgcgcgacaccgtctactgtctgaccgaagaagaggcg
gacaccgacgaaatcgaaagctccattcgcgcgatggtctcggctgttgccagttatgtg
ccgggctaccgattgaagcaagcggtgcagttcgaccgctacacggccgcgaatccgctc
gcattgcatgcaaacgagcgccgcgcgggtttgaaagtgagcgtgtttctcgaagtggag
ggcgccgcgcactacctgccttcgtatgcgggaaatctggacatcatgacatcggccgcg
ctggccgccgccgagcagatcgcggcgagccgcgtggcggcatga

DBGET integrated database retrieval system