KEGG   Burkholderia phytofirmans: Bphyt_1615Help
Entry
Bphyt_1615        CDS       T00765                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpy  Burkholderia phytofirmans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bphyt_1615
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bphyt_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1821669..1823756
Genome map
AA seq 695 aa AA seqDB search
MSTFEQSASAPPELDDIGVSLPAPADFSIALAEGFARRIGALARRGGASAEAVKWAARSA
FAASRATAEGHVCVPLAILARRFEASSAEVRTALFASGMASDGSQSSAALRPLVVDGQGR
LYLARYYDYERRLARALVAHARADEGVERLANAQTLHERLLRYFGPPKDNEVDWQRVAAV
MALSGQLTIVSGGPGTGKTTTVVGVLACLLDARTDLRIALAAPTGKAAQRMQEALLARAG
DLPPELAARLPQTSYTLHRLLGSGPGGRFRHHRDNPLPYDVVVIDEASMIDVAMAAHLLD
AIAPQTRLVMLGDKDQLAAVEAGAVFAELSARPTFTQGGLQRIADALGIDEKQLTQALPG
ASRGLGEEPTDFSAQSYVPNDDLFAYADSPGGFDEPPGGDLFESAAPPPSHIATASPMQN
PLADCVVWLERNYRFGLESPIGRLSLAIRNGSASAALDVLRTDPTETCAAALYEDTHATL
TERTVARLAAGFAPYADALATALAAEAPDPLPLFDALNRFRILCATRSGPRGVDQVNAAM
AAQVRRAAGVTLAVGAQWFAGRPVMVTRNDYALGLFNGDIGIALPGANGALRVYFRTGDG
GLRAVSPAALPPHDTAFALTVHKSQGSEFEHAVLMLPSVFSRVLSRELVYTAITRARERV
EVIGARAVLAQAIATPTQRDSGLAARIAEVWRGVE
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcgaacagagcgcatcggcgccgcctgagctcgacgacatcggcgtgagc
ctgcccgcgccagcggatttcagtatcgcgctcgccgaaggtttcgcacggcgcatcggt
gcgctggcgcggcgcggcggcgcgtcggccgaggcggtcaagtgggcggcgcgcagcgcg
ttcgccgcgagccgcgcgacggccgaaggccacgtgtgcgtgccgctcgccatactggcg
cgacgcttcgaggcgtcgagcgccgaagtgcgcaccgcgctgttcgcgagcggcatggcg
agcgatggttcgcaaagctcggcggcgttgcggccgctggtggtcgatgggcaagggcgg
ctgtatctggctcgctattacgactacgagcggcggcttgcgcgcgcgttggtggcgcat
gcgcgcgcggatgagggtgtcgagcgattggccaatgcccagaccctccacgagcgtctc
ctgcgctacttcggtccgccgaaggacaacgaagtcgactggcaacgcgtcgcggcggtc
atggcgctgtccgggcaactcaccatcgtcagcggtggaccgggcaccggcaagaccacc
accgtggtcggcgtgcttgcctgcctgctcgatgcacgcacggatctgcgcatcgcactc
gcggctcccaccggcaaagccgcgcagcgcatgcaggaggccctgctcgcgcgcgctggc
gatttgccgcctgaactcgccgcgcgtttgccgcagacgtcgtacaccttgcatcgtttg
ctcggctccgggccgggagggcgcttccggcatcatcgggacaatccgctgccttacgac
gtcgtcgtgatcgacgaggcgtcgatgatcgacgtcgccatggccgcgcatctgctcgac
gccatcgcgccgcagactcgtctcgtgatgctcggcgacaaggaccagctcgccgccgtc
gaggccggcgcggtgttcgccgaactcagcgcgcgccccacttttacgcaaggtggtttg
cagcggatcgccgacgcgctcggcatcgacgaaaagcagctcacgcaggcgttgccgggc
gcgtcgcggggcttgggcgaggagcctacggatttctccgcgcagtcatacgtgcctaac
gacgatctgtttgcatacgcggactcacctggtgggttcgacgaaccacccggcggtgac
cttttcgaaagcgccgcgccgccaccttcgcacatagccacggcgtcgcccatgcagaac
ccgctcgccgattgcgtcgtctggctcgagcgcaactatcggttcggtctggagtcgccc
atcggccgcctatcgctcgcgattcgcaacgggtcggctagcgccgcgctcgatgtcttg
cgtaccgatcccactgaaacatgcgcggcggcgctttacgaagacacgcacgcaacgctt
accgagcgcaccgtcgcacgactcgccgcaggtttcgcgccgtatgccgacgcgcttgcc
acagcgctagccgccgaagcacccgacccgttgccgcttttcgacgcgttgaaccgtttt
cgcattttgtgcgcgacccgttccggaccgcgcggcgtcgatcaggtgaatgcggcgatg
gcggcgcaggtgcggcgcgcggcgggtgtgacgctggcagtgggcgcgcagtggttcgcc
gggcgtcctgtgatggtgacgcgcaacgactacgcgctcggtctctttaacggcgacatc
ggtattgcgctgccgggcgcgaacggcgcgttgcgcgtgtatttccggaccggcgatggc
ggcttgcgagcggtatcgccggcggcgctgccgccccacgacactgcgttcgcgctcacg
gttcacaaatcgcagggttcggaattcgagcacgcggtgctgatgctgccgtcggtattc
agccgggtgttgtcccgcgaactggtgtacacggcgatcacccgcgcgcgcgaacgggtc
gaagtgatcggcgcgcgcgccgtgctggcgcaggccattgcgacgcctacacagcgcgac
tccgggttagccgcgcggatagcggaggtgtggcgcggcgttgaatag

DBGET integrated database retrieval system