KEGG   Burkholderia phytofirmans: Bphyt_1641Help
Entry
Bphyt_1641        CDS       T00765                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpy  Burkholderia phytofirmans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphyt_1641
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bphyt_1641
  Amino acid metabolism
   00310 Lysine degradation
    Bphyt_1641
Enzymes [BR:bpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bphyt_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1855067..1856353
Genome map
AA seq 428 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGKAGAAAVEAEVKPAPEAAPAPAAAAAPAAHAASATGANT
AASPAAGKLMAEKGLGAGDVSGTGRDGRITKGDVLTAGAPAAKAAPAPAPAAAPKAAKPS
LPDVKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLR
NKYKDRFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPR
GLVVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPI
INPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALED
PARLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggtcccccagctctccgagtccgtctcggaagccacgatg
ctgcagtggaaaaagaagccgggcgaggctgttgctcaagacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggctgatcaggtgatcgccaagatcgacaccgaa
ggcaaggcgggcgccgctgccgtcgaagccgaagtgaagcccgctcctgaagccgcgccg
gcacccgccgctgcagcggctccggcggctcatgccgcatccgcaacgggtgcgaatacc
gcagcttcgccggctgccggcaagctgatggccgagaagggtctgggcgcgggcgacgtg
tccggcacgggccgcgacggccgcatcaccaagggcgacgtgctgaccgccggtgctccg
gctgccaaggccgcaccggctccggcaccggccgccgcaccgaaggctgccaagccgtcg
ctgccggacgtcaaggcgccggcttcggctgatcaatggctgaaggaccgcccggaacaa
cgcgtgccgatgtcgcgtctgcgtgcgcgtatcgccgagcgtctgctcgagtcgcagcaa
accaacgccatcctgaccacgttcaacgaagtgaacatggccccggtgatggacctgcgc
aacaagtacaaagaccgcttcgagaaggaacacggcgtgaagcttggcttcatgtcgttc
ttcgtgaaggccgcggttcatgcgctgaagaagttcccgctggtgaacgcgtcgatcgac
ggtaacgacatcgtctatcacggctacttcgacatcggtatcgcggtcggttccccgcgt
ggtctggtggtgccgatcctgcgcaatgcagatcagttgagcctcgccgacatcgagaag
aagattgccgaattcggccagaaggccaaggacggcaagctgtcgatcgaagaaatgacc
ggcggtacgttctcgatctcgaacggcggtgtgttcggttcgatgctgtcgacgccgatc
atcaacccgccgcaatccgcgattctgggcgtgcacgccaccaaggaacgcgctgtggtc
gagaacggccagatcgtgatccgcccgatgaactacctggcgctgtcgtacgaccaccgc
atcatcgacggccgcgaggcggtgctgtcgctggtcgccatgaaggatgcgctggaagac
ccggcgcgcctgctgctcgacctgtaa

DBGET integrated database retrieval system