KEGG   Burkholderia phytofirmans: Bphyt_1805Help
Entry
Bphyt_1805        CDS       T00765                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bpy  Burkholderia phytofirmans
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bpy01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpy01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpy00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:bpy00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2025806..2027056
Genome map
AA seq 416 aa AA seqDB search
MPAVKPILKSNKLLNVCYDIRGPVLEHAKRLEEEGHRIIKLNIGNLAPFGFDAPDEIIQD
MILNLPGSSGYSDSKGVFAARKAIMHYTQQKGVHGVELDDIYIGNGASELIVMALQGLLN
DGDEVLLPAPDYPLWTAGVSLSGGTPVHYICDESNSWMPDLDDIRAKITPNTRALVVINP
NNPTGALYSDELLLGLIEIARQHGLVIFADEVYDKIIYDGKKHTSMAALSEDVLTVTFNS
LSKSYRSCGYRAGWMFISGLTAGENRRHAKDYFEGLGILASMRLCPNVPGQYAIQTALGG
YQSINDLIVPTGRLYKQRELAYDMLTAIPGVSCVKPEAALYMFPRLDPKIYPIQDDQQFI
LDLLLEERVLLVQGTGFNWKTPDHFRVVFLPNVDDLADSINRIARFLDGYRKRHSA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgtgaaaccgattctcaaatccaacaagttgttgaatgtctgctatgacatt
cgcgggcccgtcctcgaacatgccaagcggctcgaagaagagggccaccgcatcatcaag
ctgaacatcggcaatctcgcgccgttcggcttcgacgcgccggacgaaatcattcaggac
atgatcctgaacctgccgggttcgtcgggttattccgattccaaaggtgtgttcgccgcg
cgcaaggcgatcatgcattacacgcagcaaaaaggcgtgcacggcgtcgagctggacgac
atctacatcggcaacggcgcctccgaattgatcgtgatggcgctgcaagggctgctgaac
gacggcgacgaagtgctgctgcccgcgcccgactatccgctgtggaccgccggcgtgagc
ctgtcgggcggcacgccggtgcactatatctgcgacgaatcgaatagctggatgcccgac
ctcgacgacattcgcgcgaaaatcacgccgaatacgcgcgcgctcgtggtcatcaacccg
aacaatcccaccggcgcgctctattcggacgagctgctgctcggcctgatcgagattgcc
cgccagcacggcctcgtgatcttcgccgacgaggtctacgacaagatcatttacgacggc
aagaagcacacgtcgatggcggcgctctccgaagacgtgctgaccgtcacgttcaacagc
ctgtcgaaaagctaccgttcgtgcggttaccgcgccggctggatgttcatctcgggcttg
accgccggtgaaaaccgccgtcacgccaaagactacttcgaagggctcggcattctggcg
tccatgcgtctgtgcccgaacgtgccgggccagtacgcgatccagaccgcgctcggcggc
taccagagcatcaacgacctgatcgtgccgaccgggcgcctgtacaaacagcgcgaactc
gcctatgacatgttgacggcgattcccggcgtgagctgcgtgaagcccgaagcggcgctg
tatatgttcccgcgtctggacccgaagatctacccgatccaggatgaccagcagttcatc
ctcgaccttctactggaggagcgcgtgctgctcgtgcagggcaccggcttcaattggaaa
acgccggatcacttccgcgtcgtgttcctgccgaacgtggacgatctcgcggattccatc
aaccggatcgcgcgcttcctcgacggttaccgcaagcgtcactccgcctag

DBGET integrated database retrieval system