KEGG   Burkholderia phytofirmans: Bphyt_1805Help
Entry
Bphyt_1805        CDS       T00765                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bpy  Burkholderia phytofirmans
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Bphyt_1805
   01230 Biosynthesis of amino acids
    Bphyt_1805
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bphyt_1805
   00290 Valine, leucine and isoleucine biosynthesis
    Bphyt_1805
Enzymes [BR:bpy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Bphyt_1805
    2.6.1.66  valine---pyruvate transaminase
     Bphyt_1805
Amino acid related enzymes [BR:bpy01007]
 Aminotransferase (transaminase)
  Class I
   Bphyt_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2025806..2027056
Genome map
AA seq 416 aa AA seqDB search
MPAVKPILKSNKLLNVCYDIRGPVLEHAKRLEEEGHRIIKLNIGNLAPFGFDAPDEIIQD
MILNLPGSSGYSDSKGVFAARKAIMHYTQQKGVHGVELDDIYIGNGASELIVMALQGLLN
DGDEVLLPAPDYPLWTAGVSLSGGTPVHYICDESNSWMPDLDDIRAKITPNTRALVVINP
NNPTGALYSDELLLGLIEIARQHGLVIFADEVYDKIIYDGKKHTSMAALSEDVLTVTFNS
LSKSYRSCGYRAGWMFISGLTAGENRRHAKDYFEGLGILASMRLCPNVPGQYAIQTALGG
YQSINDLIVPTGRLYKQRELAYDMLTAIPGVSCVKPEAALYMFPRLDPKIYPIQDDQQFI
LDLLLEERVLLVQGTGFNWKTPDHFRVVFLPNVDDLADSINRIARFLDGYRKRHSA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgtgaaaccgattctcaaatccaacaagttgttgaatgtctgctatgacatt
cgcgggcccgtcctcgaacatgccaagcggctcgaagaagagggccaccgcatcatcaag
ctgaacatcggcaatctcgcgccgttcggcttcgacgcgccggacgaaatcattcaggac
atgatcctgaacctgccgggttcgtcgggttattccgattccaaaggtgtgttcgccgcg
cgcaaggcgatcatgcattacacgcagcaaaaaggcgtgcacggcgtcgagctggacgac
atctacatcggcaacggcgcctccgaattgatcgtgatggcgctgcaagggctgctgaac
gacggcgacgaagtgctgctgcccgcgcccgactatccgctgtggaccgccggcgtgagc
ctgtcgggcggcacgccggtgcactatatctgcgacgaatcgaatagctggatgcccgac
ctcgacgacattcgcgcgaaaatcacgccgaatacgcgcgcgctcgtggtcatcaacccg
aacaatcccaccggcgcgctctattcggacgagctgctgctcggcctgatcgagattgcc
cgccagcacggcctcgtgatcttcgccgacgaggtctacgacaagatcatttacgacggc
aagaagcacacgtcgatggcggcgctctccgaagacgtgctgaccgtcacgttcaacagc
ctgtcgaaaagctaccgttcgtgcggttaccgcgccggctggatgttcatctcgggcttg
accgccggtgaaaaccgccgtcacgccaaagactacttcgaagggctcggcattctggcg
tccatgcgtctgtgcccgaacgtgccgggccagtacgcgatccagaccgcgctcggcggc
taccagagcatcaacgacctgatcgtgccgaccgggcgcctgtacaaacagcgcgaactc
gcctatgacatgttgacggcgattcccggcgtgagctgcgtgaagcccgaagcggcgctg
tatatgttcccgcgtctggacccgaagatctacccgatccaggatgaccagcagttcatc
ctcgaccttctactggaggagcgcgtgctgctcgtgcagggcaccggcttcaattggaaa
acgccggatcacttccgcgtcgtgttcctgccgaacgtggacgatctcgcggattccatc
aaccggatcgcgcgcttcctcgacggttaccgcaagcgtcactccgcctag

DBGET integrated database retrieval system