KEGG   Paraburkholderia phytofirmans: Bphyt_1805Help
Entry
Bphyt_1805        CDS       T00765                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00220  Arginine biosynthesis
bpy00250  Alanine, aspartate and glutamate metabolism
bpy00290  Valine, leucine and isoleucine biosynthesis
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01130  Biosynthesis of antibiotics
bpy01210  2-Oxocarboxylic acid metabolism
bpy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bphyt_1805
   00290 Valine, leucine and isoleucine biosynthesis
    Bphyt_1805
   00220 Arginine biosynthesis
    Bphyt_1805
Enzymes [BR:bpy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Bphyt_1805
    2.6.1.66  valine---pyruvate transaminase
     Bphyt_1805
Amino acid related enzymes [BR:bpy01007]
 Aminotransferase (transaminase)
  Class I
   Bphyt_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Spherulin4
Motif
Other DBs
NCBI-ProteinID: ACD16213
JGI: Bphyt1805
UniProt: B2T3P8
Position
1:2025806..2027056
Genome map
AA seq 416 aa AA seqDB search
MPAVKPILKSNKLLNVCYDIRGPVLEHAKRLEEEGHRIIKLNIGNLAPFGFDAPDEIIQD
MILNLPGSSGYSDSKGVFAARKAIMHYTQQKGVHGVELDDIYIGNGASELIVMALQGLLN
DGDEVLLPAPDYPLWTAGVSLSGGTPVHYICDESNSWMPDLDDIRAKITPNTRALVVINP
NNPTGALYSDELLLGLIEIARQHGLVIFADEVYDKIIYDGKKHTSMAALSEDVLTVTFNS
LSKSYRSCGYRAGWMFISGLTAGENRRHAKDYFEGLGILASMRLCPNVPGQYAIQTALGG
YQSINDLIVPTGRLYKQRELAYDMLTAIPGVSCVKPEAALYMFPRLDPKIYPIQDDQQFI
LDLLLEERVLLVQGTGFNWKTPDHFRVVFLPNVDDLADSINRIARFLDGYRKRHSA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgtgaaaccgattctcaaatccaacaagttgttgaatgtctgctatgacatt
cgcgggcccgtcctcgaacatgccaagcggctcgaagaagagggccaccgcatcatcaag
ctgaacatcggcaatctcgcgccgttcggcttcgacgcgccggacgaaatcattcaggac
atgatcctgaacctgccgggttcgtcgggttattccgattccaaaggtgtgttcgccgcg
cgcaaggcgatcatgcattacacgcagcaaaaaggcgtgcacggcgtcgagctggacgac
atctacatcggcaacggcgcctccgaattgatcgtgatggcgctgcaagggctgctgaac
gacggcgacgaagtgctgctgcccgcgcccgactatccgctgtggaccgccggcgtgagc
ctgtcgggcggcacgccggtgcactatatctgcgacgaatcgaatagctggatgcccgac
ctcgacgacattcgcgcgaaaatcacgccgaatacgcgcgcgctcgtggtcatcaacccg
aacaatcccaccggcgcgctctattcggacgagctgctgctcggcctgatcgagattgcc
cgccagcacggcctcgtgatcttcgccgacgaggtctacgacaagatcatttacgacggc
aagaagcacacgtcgatggcggcgctctccgaagacgtgctgaccgtcacgttcaacagc
ctgtcgaaaagctaccgttcgtgcggttaccgcgccggctggatgttcatctcgggcttg
accgccggtgaaaaccgccgtcacgccaaagactacttcgaagggctcggcattctggcg
tccatgcgtctgtgcccgaacgtgccgggccagtacgcgatccagaccgcgctcggcggc
taccagagcatcaacgacctgatcgtgccgaccgggcgcctgtacaaacagcgcgaactc
gcctatgacatgttgacggcgattcccggcgtgagctgcgtgaagcccgaagcggcgctg
tatatgttcccgcgtctggacccgaagatctacccgatccaggatgaccagcagttcatc
ctcgaccttctactggaggagcgcgtgctgctcgtgcagggcaccggcttcaattggaaa
acgccggatcacttccgcgtcgtgttcctgccgaacgtggacgatctcgcggattccatc
aaccggatcgcgcgcttcctcgacggttaccgcaagcgtcactccgcctag

DBGET integrated database retrieval system