KEGG   Burkholderia phytofirmans: Bphyt_1807Help
Entry
Bphyt_1807        CDS       T00765                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpy  Burkholderia phytofirmans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bphyt_1807
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphyt_1807
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bphyt_1807
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bphyt_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2028495..2029946
Genome map
AA seq 483 aa AA seqDB search
MNYLSTRGAGAGERHTFSDILLGGLAKDGGLYLPAEYPRVTADELTRWRTLPYADLAFEI
LSKFSDDIPADDLRALTRKTYTAATYCNVRDDESAAQITPLKTLGVENGAPLSLLELSNG
PTLAFKDMAMQLIGNLFEYALARHGETLNILGATSGDTGSAAEYAMRGKHGISVFMLSPH
KKMSAFQTAQMYSLQDPNIFNIAVEGVFDDAQDIVKAVSNDHAFKAKYKIGTVNSINWAR
VVAQVVYYFKGYFAATKSNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGIYRVRKAAETYHTSSPSMDISKASNFERFVFDLLGRDPARVLQLFRDVEEKG
GFDLAASGDFARVKEFGFVSGSSTHDSRVDTIRDVFERYDTMIDTHTADGLKVAREHLQP
GIPMIVLETAQPIKFGETIREALLREPERPAAFSGLEALPQRFEVLPADVQRVKDFIVAN
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctctcaacgcgcggcgccggagccggcgagcgccacaccttctccgacatc
ctgctgggcggtctcgcgaaagacggcggcctgtatttgcccgcggaatatccgcgtgtc
actgctgacgaactgacgcgctggcgcacgctgccgtacgcggacctcgccttcgagatc
ctgtcgaaattcagcgacgacattcccgccgacgacctgcgcgcgctcacgcgcaagacg
tacacggcggccacgtactgcaatgttcgcgacgacgaaagcgccgcgcagatcacgccg
ttgaagacgctgggcgtcgagaacggcgcgccgctgtcgctgctggaactgtcgaacggt
ccgacgctcgcgttcaaggacatggcgatgcagttgatcggcaacctgttcgaatacgcg
ctcgcgagacacggcgaaacgctgaacattctcggcgcgacctcgggcgacaccggcagc
gccgcggaatacgcgatgcgcggcaagcacggcatcagcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagaccgcgcagatgtacagcctgcaggacccgaacatcttc
aacatcgcggttgaaggcgtgttcgacgacgcgcaggacatcgtcaaagccgtctcgaac
gatcacgcgttcaaggcgaagtacaagatcggcacggtcaactcgatcaactgggcgcgc
gtggtggcgcaggtcgtgtactacttcaagggctacttcgcggccacgaagtcgaacgac
gagcgcgtgtcgttcacggtgccgtcgggcaacttcggcaacgtgtgcgcgggtcacatc
gcgcgcatgatgggcctgccgatcgagaagctggtcgtggcgacgaacgaaaacgacgtg
ctcgacgagttcttccgcaccggcatttaccgcgtgcgcaaggcggccgagacgtatcac
accagcagcccgagcatggatatttcgaaggcctcgaacttcgagcgcttcgtgttcgat
ctgctcggccgcgatccggcgcgcgtgctgcaattgttccgcgacgtcgaagagaagggc
ggcttcgaccttgcggcgagcggcgatttcgcgcgcgtgaaggagttcggtttcgtgtcc
ggtagcagcacgcatgacagccgcgtggacacgatccgcgacgtgttcgagcgttacgac
acgatgatcgacacgcacacagccgacggcctgaaggtggcgcgcgaacatctgcagccc
ggcattccgatgatcgtgctggagacggcgcaacccatcaagtttggcgagacgatccgc
gaagcgctgttgcgcgagccggagcggccggcggcgttctcgggcctggaggcgctgccg
cagcgtttcgaagtgctgccggcggacgtgcagcgtgtgaaggacttcattgtggcgaac
gcgggcgcgtaa

DBGET integrated database retrieval system