KEGG   Burkholderia phytofirmans: Bphyt_1828Help
Entry
Bphyt_1828        CDS       T00765                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpy  Burkholderia phytofirmans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bpy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2052594..2053190
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDRDGAEKLGRSLLFATEHLQHCEKC
NTFTEAQICEVCLDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVIKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccttccgccttgtcggcgctcgtcgaagcgctgcgcgcgctgcccggcgtc
gggccgaagtccgcgcaacgcatggcgtaccacctgatgcagcacgatcgcgacggcgcc
gaaaaactcggccgctcgttgctgttcgcgactgagcatctgcagcactgcgagaagtgc
aacaccttcaccgaagcgcagatctgcgaggtctgcctcgatgaggagcgcgatcccact
ttgctgtgcgtcgtcgaaacgcctgccgaccagatcatgctcgagcagaccatgacctat
cgcggcctttacttcgtgctgatggggcgtctgagtcccctcgacggcatcggtccgaag
gagattcatttcgaccggctggtccggcgcgcttcggatggcgtgatcaaggaagtcgtg
ctcgccaccaatttcaccaacgaaggcgaggcgaccgcacattacctcgggcagacgctc
aaggcgcgcggcctcgccgtcacgcgccttgcgcgcggcgtgccggtgggcggcgaactc
gaatacgtggacgccggcacgatcgcccgcgccatgctcgaccgtcgctcgatgtag

DBGET integrated database retrieval system