KEGG   Paraburkholderia phytofirmans: Bphyt_1828Help
Entry
Bphyt_1828        CDS       T00765                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bphyt_1828
DNA repair and recombination proteins [BR:bpy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Bphyt_1828
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bphyt_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5
Motif
Other DBs
NCBI-ProteinID: ACD16236
JGI: Bphyt1828
UniProt: B2T3S5
Position
1:2052594..2053190
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDRDGAEKLGRSLLFATEHLQHCEKC
NTFTEAQICEVCLDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVIKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccttccgccttgtcggcgctcgtcgaagcgctgcgcgcgctgcccggcgtc
gggccgaagtccgcgcaacgcatggcgtaccacctgatgcagcacgatcgcgacggcgcc
gaaaaactcggccgctcgttgctgttcgcgactgagcatctgcagcactgcgagaagtgc
aacaccttcaccgaagcgcagatctgcgaggtctgcctcgatgaggagcgcgatcccact
ttgctgtgcgtcgtcgaaacgcctgccgaccagatcatgctcgagcagaccatgacctat
cgcggcctttacttcgtgctgatggggcgtctgagtcccctcgacggcatcggtccgaag
gagattcatttcgaccggctggtccggcgcgcttcggatggcgtgatcaaggaagtcgtg
ctcgccaccaatttcaccaacgaaggcgaggcgaccgcacattacctcgggcagacgctc
aaggcgcgcggcctcgccgtcacgcgccttgcgcgcggcgtgccggtgggcggcgaactc
gaatacgtggacgccggcacgatcgcccgcgccatgctcgaccgtcgctcgatgtag

DBGET integrated database retrieval system