KEGG   Burkholderia phytofirmans: Bphyt_1912Help
Entry
Bphyt_1912        CDS       T00765                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpy  Burkholderia phytofirmans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bphyt_1912
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bphyt_1912
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bphyt_1912
Lipid biosynthesis proteins [BR:bpy01004]
 Fatty acid synthase
  Component type
   Bphyt_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2150210..2150884)
Genome map
AA seq 224 aa AA seqDB search
MTTRATALTTACGCAVVAASLFSVSSTARAANAPEPARPVIVVLGDSISAEYGLPRDTGW
VALMRQRLADEQIDYSVANASISGDTTSGGRARMPALMQRLKPSIVIVELGANDALRGVP
LSTTEDNLRTIIEQAQQGHAKVVLVGMYVPPNYGPDYTQKFHGLYGELSKQLRVPLVPFL
LAGIADKPDMFQADQIHPTQQAQPVLLNNVWPAVKPLLRTSSPH
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcgcgccacggcgttgacaacggcatgcggctgcgccgtcgtggccgccagc
ctgttttcggtgagctccacggcgcgggccgccaacgcgcctgaaccggcccggccggtg
atcgtcgtgctcggcgacagcatctccgccgaatacggcctgccccgcgacacgggctgg
gttgccttgatgcgacagcgcctcgccgacgagcaaatcgattatagcgtcgccaatgcg
agcatcagcggcgacaccacgagcggcggacgagcccgcatgccggcgctcatgcaacgc
ctgaagccgagcatcgtgatcgtcgaactcggcgccaacgacgcgttgcgcggcgtgccg
ctttccaccaccgaagacaacttgcgcacgatcatcgagcaggctcagcaaggtcacgcg
aaggtcgtgctggtgggcatgtatgtgccgcctaattacggcccggactacacgcaaaag
ttccacggcttgtacggcgaactgtccaaacagttgcgcgtgccgctcgtgccgtttctg
ctcgccggcatcgccgataaaccggacatgttccaggccgatcagattcatccgacccag
caggcacagccagtgctactcaacaacgtgtggcccgcagtcaagccactccttcgcaca
agttcgccgcactga

DBGET integrated database retrieval system