KEGG   Burkholderia phytofirmans: Bphyt_1973Help
Entry
Bphyt_1973        CDS       T00765                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpy  Burkholderia phytofirmans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bphyt_1973
   00052 Galactose metabolism
    Bphyt_1973
   00500 Starch and sucrose metabolism
    Bphyt_1973
   00520 Amino sugar and nucleotide sugar metabolism
    Bphyt_1973
Enzymes [BR:bpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bphyt_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2225931..2226848
Genome map
AA seq 305 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEK
LVGESPFAVILADDLLHSSKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWE
DNVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLT
EEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKADFEAYLQAYMQGNMQEGVPAQF
AAEAA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcaccaaagccgtgtttcccgtagcgggcctcgggacacgattcctgccg
gctaccaaggcaagtcctaaggaaatgctgccgatcgtggataaaccgctgattcaatac
gcggtggaagaagcgattgccgccggcatcaccgagatgatcttcgtaacgggccgcagc
aagcgcgccattgaagatcacttcgacaagtcctacgagatcgaagccgaactcgaggcg
cgtaacaaacagaagctgctcgatctggtgcgcagcatcaagccggccaacgtcgactgt
ttctatgtgcgtcaggccgaagcgctcggtctcggtcacgcggtgctgtgcgccgagaaa
ctggtgggcgagagcccgttcgccgtgattctggccgacgacctgctgcacagctcgaag
ccggtgatgagccagctcgtcgacaccttcaatcactatcacagctcggtgatcggcgtc
gaaaccattgcgcgcgaagacagccgctcgtacggcgtggtggacggccgcgaatgggaa
gacaacgtgatcaagctgtcgggcatcgtcgagaagccagcgccggacaaggcgccgtcg
aatctcggcgtggtgggccgttatgtgttgatgccgaccattttcaagcatatccgcgcg
ttgaagccgggcgcgggtggcgagctgcaattgaccgacgcggtgcaatcgctgctgacg
gaagagcaggtgcttgcgtatcgctatttcggcacgcggttcgattgcggcagcaagctg
ggttatctgaaggcgacggtggaattcgcgctgcgccatccggaagtgaaggcggatttt
gaagcgtatttgcaggcttatatgcagggcaatatgcaggaaggcgtgccggcgcagttt
gcggcggaagcggcttag

DBGET integrated database retrieval system