KEGG   Paraburkholderia phytofirmans: Bphyt_1973Help
Entry
Bphyt_1973        CDS       T00765                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00040  Pentose and glucuronate interconversions
bpy00052  Galactose metabolism
bpy00500  Starch and sucrose metabolism
bpy00520  Amino sugar and nucleotide sugar metabolism
bpy01100  Metabolic pathways
bpy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bphyt_1973
   00052 Galactose metabolism
    Bphyt_1973
   00500 Starch and sucrose metabolism
    Bphyt_1973
   00520 Amino sugar and nucleotide sugar metabolism
    Bphyt_1973
Enzymes [BR:bpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bphyt_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACD16381
JGI: Bphyt1973
UniProt: B2T470
Position
1:2225931..2226848
Genome map
AA seq 305 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEK
LVGESPFAVILADDLLHSSKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWE
DNVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLT
EEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKADFEAYLQAYMQGNMQEGVPAQF
AAEAA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcaccaaagccgtgtttcccgtagcgggcctcgggacacgattcctgccg
gctaccaaggcaagtcctaaggaaatgctgccgatcgtggataaaccgctgattcaatac
gcggtggaagaagcgattgccgccggcatcaccgagatgatcttcgtaacgggccgcagc
aagcgcgccattgaagatcacttcgacaagtcctacgagatcgaagccgaactcgaggcg
cgtaacaaacagaagctgctcgatctggtgcgcagcatcaagccggccaacgtcgactgt
ttctatgtgcgtcaggccgaagcgctcggtctcggtcacgcggtgctgtgcgccgagaaa
ctggtgggcgagagcccgttcgccgtgattctggccgacgacctgctgcacagctcgaag
ccggtgatgagccagctcgtcgacaccttcaatcactatcacagctcggtgatcggcgtc
gaaaccattgcgcgcgaagacagccgctcgtacggcgtggtggacggccgcgaatgggaa
gacaacgtgatcaagctgtcgggcatcgtcgagaagccagcgccggacaaggcgccgtcg
aatctcggcgtggtgggccgttatgtgttgatgccgaccattttcaagcatatccgcgcg
ttgaagccgggcgcgggtggcgagctgcaattgaccgacgcggtgcaatcgctgctgacg
gaagagcaggtgcttgcgtatcgctatttcggcacgcggttcgattgcggcagcaagctg
ggttatctgaaggcgacggtggaattcgcgctgcgccatccggaagtgaaggcggatttt
gaagcgtatttgcaggcttatatgcagggcaatatgcaggaaggcgtgccggcgcagttt
gcggcggaagcggcttag

DBGET integrated database retrieval system