KEGG   Paraburkholderia phytofirmans: Bphyt_2411Help
Entry
Bphyt_2411        CDS       T00765                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00072  Synthesis and degradation of ketone bodies
bpy00650  Butanoate metabolism
bpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bphyt_2411
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bphyt_2411
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bphyt_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACD16807
JGI: Bphyt2411
UniProt: B2T5E6
Position
1:complement(2713884..2714666)
Genome map
AA seq 260 aa AA seqDB search
MALNDKVALVTGAASGIGEQCARKLAADGATVVIADLNLVNAQKVAEDIVKTGAKAIAIG
MDVTSEESVNAGVAETVRRLGSLDVLVSNAGIQIVNRIEEYPFADWKKMLAIHLDGAFLT
TKAAIRHMYASKKGGAVIYMGSVHSHEASQLKSAYVTAKHGLLGLARVVAKEGGPHGVRA
NVVCPGFVRTPLVDKQIPEQAKALGISEQQVVSDVMLKDTVDGEFTSVDDVANTVAFLAG
FESSALTGQSIVVSHGWFMQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaatgataaggtcgcgctcgttacgggcgcggcaagcggcatcggcgagcag
tgtgcacgaaagctcgcggcagacggcgcgacagtcgtgattgcggatctgaatctggtg
aacgcgcagaaggtggctgaagatatcgtaaagactggtgctaaagccattgctatcggt
atggatgtgaccagcgaagaatcagtcaatgccggtgtggctgaaacggtgcggcgactg
ggcagcctcgacgttctcgtctcgaatgcgggcattcagatcgtcaaccggatcgaagag
tatccgtttgccgattggaagaagatgcttgcgattcacctcgatggcgcgtttctcaca
accaaagccgctatcaggcacatgtacgcctccaaaaagggcggcgcggtgatctatatg
ggctcggtacattcccacgaggcgtcgcagctcaagtccgcttacgtgacagccaagcac
gggcttctcggtctcgctcgcgttgtcgcgaaggaaggcggtccgcatggcgtacgcgcg
aatgtcgtatgtcctggcttcgtcaggacaccgctggtggataagcagatccctgagcag
gccaaggctttgggtatatccgagcaacaggtggtaagcgacgtcatgttgaaagacacc
gtggacggcgaattcacgtcggtcgacgatgtcgccaacacggttgcattccttgccggg
ttcgagtcgagcgcgctcaccggccaatcgatcgtggtcagtcatggctggttcatgcag
taa

DBGET integrated database retrieval system