KEGG   Burkholderia phytofirmans: Bphyt_2486Help
Entry
Bphyt_2486        CDS       T00765                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpy  Burkholderia phytofirmans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphyt_2486
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bphyt_2486
Enzymes [BR:bpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bphyt_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2806154..2807458
Genome map
AA seq 434 aa AA seqDB search
MSRQEQVKQLQQQWETDPRWKGVKRTYTAEDVIRLRGSVQVEHTLAKRGAEKLWESVNNE
PFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDYFQPIVADAEAGFGGVLNAFELMKAMIEAGAAGV
HFEDQLASVKKCGHMGGKVLVPTRENIAKLTAARLAADVSGTPTVLLARTDAEAADLITS
DIDENDKPFLTGERTVEGFYRTKPGLEQAISRGLAYAPYADMIWCETGKPDLEFAKKFAD
AIHKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARNQMTAFVEMQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDKKVA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcaagaacaagtcaagcaactccaacagcaatgggaaaccgatccgcgctgg
aaaggcgtgaagcgcacttacacggcggaagacgtgatccgcctgcgcggttcggtgcaa
gtcgagcacacgctcgccaagcgcggtgcggaaaagctctgggaaagcgtgaacaacgag
ccgttcgtcaactcgctcggcgcgctgaccggcaaccaggccatgcagcaggtcaaggcc
ggcctcaaggcgatctatctgtcgggctggcaagtggcgggcgatgcgaacgtcgccggt
gaaatgtacccggaccagtcgctgtatccggcgaactcggtgccgctcgtcgtgaagcgc
atcaacaacacgttgacgcgcgccgaccagatccagtggtcggaaggcaagaacccgggc
gacgagggctacgtggactacttccagccgatcgtggcggatgcggaagccggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaagcgggcgccgcgggcgtg
cacttcgaagatcaactggcttcggtgaagaagtgcggtcacatgggcggcaaggtgctc
gtgccgacgcgcgaaaacatcgccaagctgacggccgcgcgtctggccgccgacgtctcc
ggcacgccgaccgtgctgctggcgcgcaccgacgcggaagccgccgacctgatcacgtcg
gacatcgacgaaaacgacaagcccttcctgacgggcgagcgcacggtggaaggtttctac
cgcaccaagccgggtctcgagcaggcaatctcgcgtggcctcgcctacgcgccgtacgcc
gacatgatctggtgcgaaaccggcaagccggacctcgagtttgcgaagaaattcgccgac
gcgatccacaaggagtacccggatcagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctggacgacgcgaccatcgccaagttccagcgcgaactcggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctatgcccgcaaccagatgacggccttcgtcgaaatgcagcaggct
gaattcgccgcggccgaaaagggcttcaccgcggtgaaacatcaacgcgaagtcggcacc
ggctacttcgacgcggtgacgcaaacggtcgaacgcgaggcttcgacgaccgcgctgcac
ggctcgacggaagacgaacagttcttcgacaagaaggtcgcgtaa

DBGET integrated database retrieval system