KEGG   Burkholderia phytofirmans: Bphyt_2800Help
Entry
Bphyt_2800        CDS       T00765                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpy  Burkholderia phytofirmans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bphyt_2800
   00052 Galactose metabolism
    Bphyt_2800
   00500 Starch and sucrose metabolism
    Bphyt_2800
   00520 Amino sugar and nucleotide sugar metabolism
    Bphyt_2800
Enzymes [BR:bpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bphyt_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3165289..3166170
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKPSHVDCFYVRQPEALGLGHAVMCAEK
LVGDNPFAVILADDLLYGTPPVMTQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWE
DSIIKMSGIVEKPEPSVAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIQSLLA
DEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLRTRSPVLEG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagttacaaaggcggtttttccggtagcaggtcttggcacccggttcctcccg
gccacgaaggcgagcccgaaagagatgctcccgattgtcgacaagccgctgatccagtac
gcggtggaagaggcaatggcggccggcatcaccgaaatgatcttcgtcacgggccgcagc
aagcgcgcgatcgaggaccacttcgataagtcgtatgaaatcgaggcggaactcgaggca
cgcggcaaggacaagctgctggaactcgtgcgcagcatcaagccgagccatgtggactgc
ttctacgtgcgtcagccggaagcgctgggcctgggccacgcggtgatgtgcgccgaaaag
ctggtgggcgacaacccgttcgccgtcattctcgcggacgacttgctgtacggcacgccg
cccgtcatgacgcagatgatcgaggtgttcgaccactatcacagctcggtgatcggcgtc
gaagagattcccgctcaggaaaccaagtcgtacggtatcgtcgacggcaaggagtgggaa
gactcgatcatcaagatgtcgggcatcgtcgagaagccggagccgagcgtggcgccgtcg
aatctcggcgtggtgggccgctatgtgctgaagccgcgcatcttcgaacatctgcgtgcg
ttgaagccgggcgcgggcggcgaattgcagctgacggacgcaatccaatcgctgctcgcc
gacgaacaggtgctggcgtacaagtatcacggcacgcgtttcgactgcggcagcaagctg
ggttatctgaaggcgaccgtcgagttcgccttgcgtcacccggaagtggctgccgatttc
gaagaatatctgcgcacgcgttcgccggtgctggagggttga

DBGET integrated database retrieval system