KEGG   Paraburkholderia phytofirmans: Bphyt_2861Help
Entry
Bphyt_2861        CDS       T00765                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00790  Folate biosynthesis
bpy01100  Metabolic pathways
Module
bpy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bphyt_2861
Enzymes [BR:bpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Bphyt_2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACD17255
JGI: Bphyt2861
UniProt: B2SZR7
Position
1:complement(3233958..3234857)
Genome map
AA seq 299 aa AA seqDB search
MSKVESPLLPIPEPLQCGRFKLTFERPLVMGILNVTPDSFSDGGKYAMRGDALRQAERMM
LDGADIIDIGGESTRPGAPPVPLDEELERVIPLVEQLRGANVPLSIDTYKPEVMRHTLAA
GADLINDIWGFRMPGAIDAVRDSECGLCVMHMLGEPQTMQLGEPVYDDVVREVRDFLEER
IAALEQAGIARARISVDPGFGFGKTVVEHNYTLLAHLSDTAPRAEPPYPILAGMSRKSMV
GAVVGRPAPERVAGSIAAAVCAAERGAAILRVHDVAQTVDALKVWAAMRDAGNHSRARG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaaagtcgaatcccctttgttgcccattcccgagccgctgcaatgcggccgtttc
aagctgacctttgaacgcccgttggtcatgggcattctgaacgttactcccgattctttt
tccgacggcggcaaatacgcgatgcgcggcgatgcgttgcgccaggccgagcgtatgatg
ctcgacggcgcggacatcatcgatatcggcggcgaatcgacgcgccccggcgcgccgccg
gtgccgctcgacgaagagctggagcgggtgatcccgctcgtcgagcaattgcgcggcgcg
aatgtgcccttgtcgatcgacacctacaagcccgaagtgatgcgccacacgctggccgcc
ggcgccgatctgatcaacgatatctggggcttccggatgcccggcgcgatcgacgcggtg
cgcgacagcgagtgcggcctgtgcgtgatgcacatgctcggcgagccgcagaccatgcag
ctcggtgagccggtctacgacgatgtggtgcgtgaagttcgcgattttctcgaggagcgc
atcgcggcactcgagcaggcgggcattgcgcgtgctcgtatcagcgtggacccgggtttc
ggcttcggcaagaccgtagtcgagcataattacacgctgctcgcgcatctgtcggatacg
gcgccgcgagccgaaccgccgtatccgattcttgccggcatgtcgcgcaagtcgatggtc
ggcgcggtggtgggacgcccggcgccggaacgcgtcgcgggcagtattgcggcggcggtg
tgcgccgctgaacggggcgctgcgattctgcgcgtgcacgacgtcgcgcaaacggtagat
gcattgaaagtatgggcagccatgcgcgacgcggggaatcacagccgcgcgcgcggttga

DBGET integrated database retrieval system