KEGG   Burkholderia phytofirmans: Bphyt_2964Help
Entry
Bphyt_2964        CDS       T00765                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpy  Burkholderia phytofirmans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bphyt_2964
   00670 One carbon pool by folate
    Bphyt_2964
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bphyt_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3349394..3349894
Genome map
AA seq 166 aa AA seqDB search
MTTLTLIVARANNGVIGRDNQLPWRLPEDLAFFKRTTMGAPIIMGRKTHESIGRPLPGRR
NIIVTRDATRRFQGCDAATTLEDALKLAAQDQAPEAFLIGGAQLYAEGLRQADKLIITEI
SADFEGDATFPALDENEWEEVAHETHRADAPNDFDYAFVTYKRKGA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctcaccctgatcgtcgctcgcgccaacaatggcgtgatcggccgcgacaac
cagttgccctggcgacttcccgaagacctcgcgttcttcaagcgcaccaccatgggcgcg
cccatcatcatgggacgcaagacgcacgagtcgatcggccggccgttgccgggacgccgc
aacattatcgtgacacgggatgccacgcggcgtttccagggctgcgacgcggccaccacg
ctcgaagacgcgctcaagctcgccgctcaggaccaggcgccggaagcgtttctgatcggc
ggcgcgcagttgtatgcggaaggtttgcggcaggcggacaagctgatcatcaccgagatt
tccgccgacttcgaaggcgacgccactttcccggcgctcgatgaaaacgagtgggaagaa
gtcgcgcatgaaacgcatcgcgcggatgcgccgaacgatttcgactacgcgttcgtgacg
tataagcgcaaaggcgcttaa

DBGET integrated database retrieval system