KEGG   Burkholderia phytofirmans: Bphyt_3345Help
Entry
Bphyt_3345        CDS       T00765                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpy  Burkholderia phytofirmans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bphyt_3345 (ruvA)
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bphyt_3345 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3764665..3765246
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGVLLEKNPPHLLIDCNGVGYEVDVPMSTFYNLPSTGERVVLLTQMIVREDAHLL
YGFGTAEERSTFRELLKISGIGARMALAVLSGMSVHELAQTVTMQDAARLTRVPGIGKKT
AERLLLELKGKIGADLGAMAGAASASDHASDILNALLALGYSEKEALTAVKNVPAGTGVS
EGIKLALKALSKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcattgccggcgttctgctggaaaaaaacccgccgcatctgctcatcgac
tgcaacggcgtcggttacgaagtggatgtgccgatgagcacgttctacaacctcccctcc
accggcgaacgcgtcgtgttgctcacacagatgatcgtccgcgaagacgcacacctgctg
tacggcttcggcaccgcggaggaacgctcgacgttccgcgaactgctgaaaatatccggc
atcggtgcgcgcatggcgttggcggtgctctccggcatgagcgtgcacgaactcgcgcag
accgtcaccatgcaggacgcggcgcgtctgacgcgcgtgccgggcatcggcaagaagacg
gcggagcgcctgctcctcgaactgaagggcaagatcggcgccgacctgggcgcgatggcg
ggcgcggcatcggcatccgaccacgcctccgacatcctgaacgcactgctcgcattgggt
tactccgaaaaggaagcgttgaccgccgtcaaaaacgtgccggccggcactggtgtttct
gaggggatcaagctcgcgttgaaggcgctctccaagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system