KEGG   Paraburkholderia phytofirmans: Bphyt_3345Help
Entry
Bphyt_3345        CDS       T00765                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bphyt_3345
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bphyt_3345
DNA repair and recombination proteins [BR:bpy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bphyt_3345
    RecFOR pathway proteins
     Bphyt_3345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 HHH_3 Transposase_20 Cdd1 IMS_HHH 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: ACD17736
JGI: Bphyt3345
UniProt: B2SYK1
Position
1:3764665..3765246
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGVLLEKNPPHLLIDCNGVGYEVDVPMSTFYNLPSTGERVVLLTQMIVREDAHLL
YGFGTAEERSTFRELLKISGIGARMALAVLSGMSVHELAQTVTMQDAARLTRVPGIGKKT
AERLLLELKGKIGADLGAMAGAASASDHASDILNALLALGYSEKEALTAVKNVPAGTGVS
EGIKLALKALSKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcattgccggcgttctgctggaaaaaaacccgccgcatctgctcatcgac
tgcaacggcgtcggttacgaagtggatgtgccgatgagcacgttctacaacctcccctcc
accggcgaacgcgtcgtgttgctcacacagatgatcgtccgcgaagacgcacacctgctg
tacggcttcggcaccgcggaggaacgctcgacgttccgcgaactgctgaaaatatccggc
atcggtgcgcgcatggcgttggcggtgctctccggcatgagcgtgcacgaactcgcgcag
accgtcaccatgcaggacgcggcgcgtctgacgcgcgtgccgggcatcggcaagaagacg
gcggagcgcctgctcctcgaactgaagggcaagatcggcgccgacctgggcgcgatggcg
ggcgcggcatcggcatccgaccacgcctccgacatcctgaacgcactgctcgcattgggt
tactccgaaaaggaagcgttgaccgccgtcaaaaacgtgccggccggcactggtgtttct
gaggggatcaagctcgcgttgaaggcgctctccaagggctga

DBGET integrated database retrieval system