KEGG   Burkholderia phytofirmans: Bphyt_3504Help
Entry
Bphyt_3504        CDS       T00765                                 

Definition
thiol-disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpy  Burkholderia phytofirmans
Brite
Enzymes [BR:bpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bphyt_3504
Secretion system [BR:bpy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bphyt_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3948826..3949551)
Genome map
AA seq 241 aa AA seqDB search
MKKTFRMAAAVLAIAAVTIGCSAQADQTTDKLKATLQTRLADVSIKSVTKSPIAGLYEVN
LGTQIVYSDANGDYLLLGDMVDAKTRKNLTEARLSETNRIDFASLPFGNAVKVVKGNGAR
KIAVFSDPNCPYCKQLETSLKSIDNVTVYTFLYPVLSPDSTAKSKSIWCSTDRAKAWESW
MQDHQAPTAAGTCDTAAIDKNLALGHAMNVDGTPTVFLADGRRLPGAVPADRLDKEMSAV
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactttccgcatggcagccgccgtgcttgccatcgccgccgtcacgatcggc
tgctccgcgcaggccgaccagaccaccgacaagctcaaggccacgctgcaaacgcggctc
gccgacgtgtcgatcaagagcgtgacgaagtcgccgattgccggcctgtacgaagtgaac
ctcggcacgcagatcgtctatagcgacgcgaatggcgactacctgttgctcggcgacatg
gtcgacgccaagacccgcaagaatctgaccgaagcgcgcctgtcggaaaccaaccgtatc
gatttcgcgagcctgccgttcggcaacgcggtgaaggtcgtgaagggcaacggcgcgcgc
aagatcgccgtgttctccgatccgaactgtccgtactgcaagcagctcgaaacgtcgctc
aagtcgatcgacaatgtgacggtctacaccttcctgtacccggtgttgtcgccggattcg
actgccaagtcgaagtcgatctggtgctcgacggatcgcgcgaaggcctgggagtcgtgg
atgcaggatcaccaggcgcccaccgccgccggcacctgcgacaccgccgcgatcgacaag
aacctcgcgctcggccacgccatgaacgtcgacggcacgcccacggtgtttctcgccgac
ggccgccgtctgcccggcgccgtgccggctgaccggctggacaaggaaatgtccgcggtg
cactga

DBGET integrated database retrieval system