KEGG   Burkholderia phytofirmans: Bphyt_3561Help
Entry
Bphyt_3561        CDS       T00765                                 

Gene name
hisG
Definition
ATP phosphoribosyltransferase catalytic subunit (EC:2.4.2.17)
Orthology
K00765  
ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
bpy  Burkholderia phytofirmans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bpy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4002120..4002818)
Genome map
AA seq 232 aa AA seqDB search
MSAMPQTSSSPAVSAPLTLALSKGRIFEETLPLLAAAGIEVAEDPETSRKLILPTTDANL
RVIIVRATDVPTYVEYGAADFGVAGKDVLLEHGGSGLYQPVDLDIARCRMSVAVAAGFDY
ANAVRQGARLRVATKYVETAREHFAAKGVHVDLIKLYGSMELAPLVGLADAIVDLVSSGN
TLRANNLVEVEEIMQISSRLVVNQAALKLKRAALRPILDAFERASKAGAATA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatgccgcaaacttcgtcgtcgccggcagtgagcgcaccgctcacgctggcg
ttgtcgaaagggcgtatcttcgaggaaacgttgccgctgctcgccgcagccggcattgaa
gtggctgaagacccggaaacctcgcgcaagctgattctgccgaccaccgacgcgaacctg
cgcgtgatcatcgtgcgcgccaccgacgtgccgacctacgtcgaatacggcgcggcggac
ttcggcgtggcgggcaaagacgtgctgctcgaacacggcggcagcggcctgtatcaaccg
gtcgatctggatattgcgcgctgccgcatgtcggtcgcggtggccgccggttttgattac
gcgaacgcggtgcgccagggcgcgcgcttgcgcgtcgcgaccaagtacgttgaaacagca
cgtgagcatttcgccgccaagggcgtgcacgtcgatctgatcaagctgtacggttcgatg
gaactggcgccgctggtcggtctcgccgatgcgatcgtcgacctggtgagttcgggcaat
accttgcgcgccaacaatctggtcgaggtggaggagatcatgcagatttcgtcgcgcctc
gtggtgaaccaggcggcgctgaaactcaagcgcgcggcgttgcggccgatcctcgacgca
ttcgaacgcgcgtcgaaggccggcgccgcgacggcctga

DBGET integrated database retrieval system