KEGG   Burkholderia phytofirmans: Bphyt_3613Help
Entry
Bphyt_3613        CDS       T00765                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bpy  Burkholderia phytofirmans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bphyt_3613
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bphyt_3613
Exosome [BR:bpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphyt_3613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4056992..4057990
Genome map
AA seq 332 aa AA seqDB search
MSFYPHHRPRRMRRDDFSRRLMRENILTTNDLIYPVFIVEGSNVRQAVPSMPGVERVSVD
LLMGVAEQCVELGVPVLSLFPAIEPSLKTPDGREATNPAGLIPRAVRELKKNFPELGVLT
DVALDPYTSHGQDGVLDEAGYVINDETVEILVEQARAQAEAGVDIVAPSDMMDGRIGAIR
EMFESEGHVHTRIMAYAAKFASAFYGPFRDAVGSATNLGKSNKMTYQMDPANSNEALREV
QADINEGADMVMVKPGMPYLDIVRRVKDEFQFPTYVYQVSGEYAMLKAAAQNGWLDHDKA
MMESLLAFKRAGADGVLTYFALDAARILRSQK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcttctatccgcaccaccgtccgcgccgcatgcgccgcgacgacttctcgcgccgt
ctgatgcgggaaaacatcctcaccaccaacgatctgatttatccggtctttatcgtcgaa
ggcagcaacgtgcggcaagccgttccgtccatgccgggcgtcgaacgcgtgtcggtcgat
ctgctgatgggcgtggctgaacagtgtgtcgaactgggcgtgcccgtgctgtcgctgttt
ccggcgatcgaaccatcgctgaaaactcccgatggtcgcgaagcgaccaaccccgccggt
ttgattccgcgcgcggttcgcgaactgaagaagaatttccccgagctgggcgtgctcacc
gatgtggcgctcgacccgtacacgagccacggccaggacggcgtgctcgacgaagccggc
tacgtgatcaacgacgagaccgtcgagattctggtcgaacaggcgcgtgcgcaggctgaa
gcgggcgtcgatatcgtcgcgccttcggacatgatggacggccgcatcggcgcgatccgc
gaaatgttcgagagtgaaggccatgtccacacacggatcatggcttatgcggccaagttc
gcgtcggccttctacggcccgttccgcgacgccgtcggctccgcgacgaacctcggcaaa
agcaacaagatgacctatcagatggatccggccaattcgaatgaggcgctgcgcgaagtg
caagcggacatcaacgaaggcgcggacatggtgatggtcaagccgggcatgccgtatctg
gacatcgtgcgtcgcgtgaaggacgagttccagtttccgacgtatgtgtatcaggtgagc
ggcgagtacgcgatgctgaaagcggccgcgcagaacggctggctcgatcacgacaaggcg
atgatggaatcgctgctggcgttcaagcgggcgggtgccgacggggtgctgacctatttc
gcattggatgccgcgcggatcttgcgttcgcagaagtga

DBGET integrated database retrieval system