KEGG   Burkholderia phytofirmans: Bphyt_3809Help
Entry
Bphyt_3809        CDS       T00765                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpy  Burkholderia phytofirmans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bphyt_3809
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bphyt_3809
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bphyt_3809
Two-component system [BR:bpy02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bphyt_3809
Bacterial motility proteins [BR:bpy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bphyt_3809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4260362..4261450)
Genome map
AA seq 362 aa AA seqDB search
MQKIKVLCVDDSALIRSLMTEIINGQPDMTVVATAPDPLVARDLIKQHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGNEITLRALELGAVDFVTKPKVGIRDGMLDYS
EKLADKIRAAARARVRQAAPAQHAAAHATQAPVGAAPLFNNPLLSTEKLIIVGASTGGTE
AIREVLVPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRITVKEAEHGERVLPGHAYIAP
GHAHLLLARSGANYIAHLSDEPPVNRHRPSVDVLFRSAAQHAGKNAVGVILTGMGRDGAA
GLLDMKKAGAYTLAQDEASCIVFGMPREAIALGAADEIAALPEMSRRVMARLSAMGDRVQ
RV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaagatcaaagtactgtgcgtcgacgattcggcgctgatccgcagcctgatgacg
gaaatcatcaacggccagccggacatgacggtggtggcgaccgcacccgacccgctggtc
gcgcgcgatctcatcaaacagcacaatccggacgtgttgacgctcgacgtcgaaatgccg
cgcatggatggtctcgatttccttgagaagctgatgcgcctgcggccgatgccggtcgtg
atggtgtcgtcgctgaccgagcgcggcaatgaaatcacgctgcgcgcgctcgaactcggc
gcggtcgatttcgtcaccaagccgaaggtcggcattcgcgacggcatgctcgattactcg
gaaaagctcgccgacaagattcgcgccgccgcgcgcgcacgtgtgcgccaggccgcgccg
gcgcagcacgcggctgcccatgcgacgcaggcgccggtcggcgcggctccgctcttcaac
aatccgctgctcagtaccgagaagctgatcatcgtcggcgcgtcgacgggcggcacggaa
gcgatccgcgaagtgctggtgccgctgccgccggatgcgcccgcagtgctgatcgcgcag
catatgccgccgggcttcacaaaatcttttgcgcaacgcctcaatggtttgtgccggatt
accgttaaagaggcagagcacggcgaacgcgtgctgccgggacatgcttacattgcgccc
ggccacgctcatctgttgcttgcccgcagtggtgcgaactatattgctcacctgtcggac
gagccgccggtgaaccggcatcgtccgtcggtggacgtgctgttccgttcggccgcgcag
catgcgggcaagaacgcggtcggcgtgattctgaccgggatggggcgcgacggcgcagcc
ggactgctggacatgaaaaaggcaggggcgtacacccttgcgcaggacgaagcgagctgt
atcgtgttcggcatgccgcgtgaagcgattgcgcttggcgcggcggacgagatcgcggcg
ttgccggaaatgagccgacgtgtgatggcgcgtctctcggcaatgggcgaccgcgttcag
cgggtatga

DBGET integrated database retrieval system