KEGG   Burkholderia phytofirmans: Bphyt_3974Help
Entry
Bphyt_3974        CDS       T00765                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bpy  Burkholderia phytofirmans
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4451268..4452284)
Genome map
AA seq 338 aa AA seqDB search
MKIGIVNDMPLAVEALRRALAARHDYEVLWIAQDGQQAIDFCTAQRPDIVLMDLVMPNVD
GIEATRRIMARAPCAILVVTVDVGANAWRVYEAMGAGALDAVDTPSLNGPDAHKSIATLI
AKIDRIAALVKERNAPGAAAATAPACVTNRDTPLVAIGASAGGPAALATLLAGLPKDFAA
AIVIVQHVDAAFAAGMADWLNQQSAVPVRIAREGDRPQAGVALLAATDDHLHLKLPNVLG
YTRVPEETPYRPSVDVFFHSVVARWPARAVGVLLTGMGRDGAIGLKAMRTKGYHTIAQDE
ATSAVYGMPKAAAALDAAAAILPLPRIAAALVTAVDAR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggaatcgtcaacgacatgccgcttgccgtcgaggcgctgcgccgcgcgctc
gcggcgcgccacgactacgaagtgttgtggatcgcgcaggacggccagcaggcgatcgat
ttctgcaccgcgcagcggcccgacatcgtgctgatggatctggtgatgccgaacgtcgac
ggcatcgaggccacgcgccgcatcatggcgcgcgcgccgtgcgcgatcctggtcgtcacc
gtcgacgtgggcgcgaacgcatggcgcgtctatgaagcgatgggcgcgggcgcgctcgat
gccgtcgatacgccttcgctgaacggtcccgacgcgcacaagagcatcgccacgttgatc
gcgaagatcgaccgcatcgcggcgctcgtcaaggaacgcaacgcgcctggtgcggcagcc
gcgacagcgcccgcctgcgtgacgaatcgcgacacgccgctagtggcgatcggcgcatcg
gcgggcggaccggcggcgcttgcgacactgctcgccggcctgccgaaggatttcgcggcg
gccatcgtgatcgtgcagcacgtcgacgcggcgttcgccgccggcatggcggactggctg
aaccagcagtcggcggtgccggtgcggatcgcccgtgaaggcgaccgcccgcaagcgggc
gtcgcgctgctcgccgccaccgacgatcatctgcatctgaaactgcccaatgtgctcggc
tatacgcgcgtgccggaagagacgccttaccggccttccgtcgacgtgttctttcatagc
gtggtggcgcgctggccggcgcgcgcggtcggcgtgctgctgaccggcatgggccgcgac
ggcgcgatcggacttaaagcgatgcgcaccaagggctatcacacgatcgcgcaggacgag
gcgaccagcgccgtgtacggtatgccgaaagcggccgcggcactcgacgccgccgccgcg
attctgccgttgccgcgcatcgccgccgcgctcgtgacggcggtcgacgcgcgctaa

DBGET integrated database retrieval system