KEGG   Burkholderia phytofirmans: Bphyt_4255Help
Entry
Bphyt_4255        CDS       T00765                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
bpy  Burkholderia phytofirmans
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Bphyt_4255
Enzymes [BR:bpy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Bphyt_4255
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Bphyt_4255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:301771..302550
Genome map
AA seq 259 aa AA seqDB search
MNAGSNTMELVALPGIPGVREGDDVGDLVADAMARTGRQWQTGDIVVIAQKIVSKAEGRT
RRLADIYPSHMAWEYASVSDKDPRKVQAMLDESVDVVRVAKVGPDGLMITRHRHGWVCAN
AAIDESNVGEDGTMLLLPVDPDASAAEVARKLEARGGIKAGVIISDTFGRAWRRGLVNVA
IGAANVPVIVDWIGRVDAYGRPLQISQPAFADEVAAAAGLLMGKDSFTPVVLVRGLSWDI
DNGAHARQLVRPLEEDLFQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggaagcaacaccatggaactggtcgccttacctggcattccgggagtgcgc
gaaggggacgacgtgggtgacctggtcgccgacgcgatggcgcgcaccggacgccaatgg
cagaccggcgacatcgtcgtgatcgctcagaagatcgtgtccaaagcggaaggccgcacc
cggcgcctcgccgatatctacccatcccacatggcgtgggagtacgcgagcgttagcgac
aaggatccccgcaaggttcaggccatgcttgacgagtctgtggacgtggtgcgggtggca
aaggtggggccggacggcctgatgatcacgcgccaccggcatggctgggtctgcgccaac
gccgccatcgacgaaagcaatgtcggtgaagacggcacgatgctgctgctgccggtcgac
cccgacgccagcgcggccgaggtggcgcgcaagctggaggcgcgcggcggcatcaaggct
ggcgtgatcatcagcgacacctttgggcgcgcgtggcggcgcgggctggtcaacgtggcc
atcggcgcggccaacgtgccggtgatcgtcgactggatcggccgggtggatgcctatggc
cgtccgctgcagatttcacagccggcgttcgccgatgaggtagcggcggcagccggactg
ctgatggggaaggacagcttcacgcctgtggtgctcgtgcgcgggctgagctgggacatc
gacaacggcgctcatgccaggcagctggtgcgccctttggaggaggacttgttccaatga

DBGET integrated database retrieval system