KEGG   Burkholderia phytofirmans: Bphyt_4585Help
Entry
Bphyt_4585        CDS       T00765                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bpy  Burkholderia phytofirmans
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpy00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:664804..666786
Genome map
AA seq 660 aa AA seqDB search
MRLGVCYYPEHWPESMWQDDARRMKALGIEQVRIAEFAWSRIEPTPGEYDWGWLDRSIDV
LGAAGLQVVMCTPTATPPKWLIDRHPDILPVGADGRPRAFGSRRHYDFSSPSYFAASQKI
CTAVAERYGKHPAVAYWQTDNEFGCHHTVVSYSPAAVGRFREWLKARYQTIDALNRAWGT
VFWSMEYRSFDEIDAPVATVTEAHPSHRLDYRRFASDEVARYNRMQVEIIRAHSPGRPVA
HNFMQLFTEFDHYKVAADLDVATWDSYPLGALEEQWFAPEVKARWLRSGHPDFASFNHDV
YRGMSKLPFWVMEQQPGPVNWALWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDVGGNEASQVAGEIRTVLAANADADAAVRSKVALVYDYEAKWLFEI
HPQGADFHYPRFAFEYYSALRALGLDVDVVPVDAPLDGYSLIVVPPLPVVPEAFAQRLAS
SGAQVVLGPRTGSKTKDLQIPANLPPGALTSVLPLRVWRVESMRPNVTEAVRLADGESAG
EADGFARHWRDFIDTDAAQSLDVRARFADGHPAYVQGGAFHYLASLFDDALTVRLFARIA
QEAGLETMPLGDSVRVSRRGALTYVFNYGDETHTLSGVADDALVFGSRAIEPQGVAVYRS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttggagtctgttattacccggaacactggccggagtcgatgtggcaagacgac
gctcgccggatgaaagccctcggcatcgagcaggtgcggatcgccgaatttgcctggagc
cgcattgagcccacgccgggcgaatacgattggggctggctcgaccgttcgatcgacgtg
ctcggcgcggccggcctgcaagtggtgatgtgcacgccgaccgcgacgccgcccaagtgg
ctgatcgaccgccatcccgacattctgccggtcggcgccgatggccgtccgcgcgcgttc
ggctcgcggcgtcattacgacttttcgtcgccgtcgtatttcgccgcatcgcagaagatt
tgcacggcggtggccgagcgctacggtaagcatccggctgtcgcttactggcaaaccgac
aatgagttcggctgccatcacacggtggtcagctattcgccggcggctgtcgggcgcttt
cgcgagtggctcaaagcgcgctatcaaaccatcgacgcgttgaaccgcgcgtggggcacg
gtgttctggagcatggagtaccgcagcttcgacgagatcgacgcgccggtggcgaccgtg
acggaagcgcacccttcgcatcgcctcgactaccggcgtttcgcctctgacgaagtggcg
cgctataaccgcatgcaggtcgagatcatccgcgcgcattcgccggggcggccggtcgcg
cacaacttcatgcaactcttcaccgagttcgatcactacaaggtcgccgccgatctcgat
gtggctacctgggacagttatccgctcggcgcgctcgaagagcaatggttcgcaccggaa
gtgaaagcgcgctggctgcgcagcgggcatccggacttcgcgtcgttcaatcacgacgtt
tatcgtggcatgtcgaagctgccgttctgggtgatggagcagcagccgggtccggtgaac
tgggcgctgtggaatccggcgccgctgccgggcatggtgcggctgtggagttgggaggcg
ttcgcgcatggcgcgggctgcgtgtcgtatttccgctggcgtcaggcgccgtttgcgcag
gagcagatgcatgcaggtttgaacacgccggacaatcgtctggacgtgggcggcaacgaa
gcgtcgcaagttgccggcgagattcgcacggtgctcgccgcgaatgccgatgccgacgcc
gcggtccggtcgaaagtcgcgctcgtctacgactacgaggcgaagtggctcttcgagatt
cacccgcagggagcggactttcactatccgcgcttcgccttcgagtattactcggcgttg
cgtgcgcttgggctcgacgtggatgtcgtgccggtggatgcgccgctggacggctatagc
ctgatcgtcgtgccgccgctgccggtcgtgcccgaggcgtttgcgcagcgtctggcgagt
tcgggtgcgcaggtcgtgctcggtccgcgcacgggttcgaagaccaaagatttgcagatt
ccggcgaacctgccgcctggtgcgctgacttcggtgttgccgttgcgcgtgtggcgggtc
gaatcgatgcggccgaacgtgactgaagcagtgcggctcgctgacggcgaaagtgctggc
gaagcagacggtttcgcccgtcactggcgtgatttcatcgacaccgatgcggcgcaatcg
ctcgacgtgcgggcccgattcgcggacggccatcccgcgtatgtacaaggcggcgcgttc
cattacctcgcgagtctgttcgacgacgcgctcacggtgcgtctttttgcgcggatcgca
caggaagcggggctcgaaacgatgccgctcggcgacagcgtgcgagtgagccgtcgcggc
gcgctgacctatgtgttcaactacggcgacgaaacgcacacgctcagcggcgtagccgac
gacgcccttgtgttcggttcgcgcgcgatcgaaccgcagggtgtggccgtctatcgatca
tga

DBGET integrated database retrieval system