KEGG   Burkholderia phytofirmans: Bphyt_4585Help
Entry
Bphyt_4585        CDS       T00765                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bpy  Burkholderia phytofirmans
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bphyt_4585
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bphyt_4585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:664804..666786
Genome map
AA seq 660 aa AA seqDB search
MRLGVCYYPEHWPESMWQDDARRMKALGIEQVRIAEFAWSRIEPTPGEYDWGWLDRSIDV
LGAAGLQVVMCTPTATPPKWLIDRHPDILPVGADGRPRAFGSRRHYDFSSPSYFAASQKI
CTAVAERYGKHPAVAYWQTDNEFGCHHTVVSYSPAAVGRFREWLKARYQTIDALNRAWGT
VFWSMEYRSFDEIDAPVATVTEAHPSHRLDYRRFASDEVARYNRMQVEIIRAHSPGRPVA
HNFMQLFTEFDHYKVAADLDVATWDSYPLGALEEQWFAPEVKARWLRSGHPDFASFNHDV
YRGMSKLPFWVMEQQPGPVNWALWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDVGGNEASQVAGEIRTVLAANADADAAVRSKVALVYDYEAKWLFEI
HPQGADFHYPRFAFEYYSALRALGLDVDVVPVDAPLDGYSLIVVPPLPVVPEAFAQRLAS
SGAQVVLGPRTGSKTKDLQIPANLPPGALTSVLPLRVWRVESMRPNVTEAVRLADGESAG
EADGFARHWRDFIDTDAAQSLDVRARFADGHPAYVQGGAFHYLASLFDDALTVRLFARIA
QEAGLETMPLGDSVRVSRRGALTYVFNYGDETHTLSGVADDALVFGSRAIEPQGVAVYRS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttggagtctgttattacccggaacactggccggagtcgatgtggcaagacgac
gctcgccggatgaaagccctcggcatcgagcaggtgcggatcgccgaatttgcctggagc
cgcattgagcccacgccgggcgaatacgattggggctggctcgaccgttcgatcgacgtg
ctcggcgcggccggcctgcaagtggtgatgtgcacgccgaccgcgacgccgcccaagtgg
ctgatcgaccgccatcccgacattctgccggtcggcgccgatggccgtccgcgcgcgttc
ggctcgcggcgtcattacgacttttcgtcgccgtcgtatttcgccgcatcgcagaagatt
tgcacggcggtggccgagcgctacggtaagcatccggctgtcgcttactggcaaaccgac
aatgagttcggctgccatcacacggtggtcagctattcgccggcggctgtcgggcgcttt
cgcgagtggctcaaagcgcgctatcaaaccatcgacgcgttgaaccgcgcgtggggcacg
gtgttctggagcatggagtaccgcagcttcgacgagatcgacgcgccggtggcgaccgtg
acggaagcgcacccttcgcatcgcctcgactaccggcgtttcgcctctgacgaagtggcg
cgctataaccgcatgcaggtcgagatcatccgcgcgcattcgccggggcggccggtcgcg
cacaacttcatgcaactcttcaccgagttcgatcactacaaggtcgccgccgatctcgat
gtggctacctgggacagttatccgctcggcgcgctcgaagagcaatggttcgcaccggaa
gtgaaagcgcgctggctgcgcagcgggcatccggacttcgcgtcgttcaatcacgacgtt
tatcgtggcatgtcgaagctgccgttctgggtgatggagcagcagccgggtccggtgaac
tgggcgctgtggaatccggcgccgctgccgggcatggtgcggctgtggagttgggaggcg
ttcgcgcatggcgcgggctgcgtgtcgtatttccgctggcgtcaggcgccgtttgcgcag
gagcagatgcatgcaggtttgaacacgccggacaatcgtctggacgtgggcggcaacgaa
gcgtcgcaagttgccggcgagattcgcacggtgctcgccgcgaatgccgatgccgacgcc
gcggtccggtcgaaagtcgcgctcgtctacgactacgaggcgaagtggctcttcgagatt
cacccgcagggagcggactttcactatccgcgcttcgccttcgagtattactcggcgttg
cgtgcgcttgggctcgacgtggatgtcgtgccggtggatgcgccgctggacggctatagc
ctgatcgtcgtgccgccgctgccggtcgtgcccgaggcgtttgcgcagcgtctggcgagt
tcgggtgcgcaggtcgtgctcggtccgcgcacgggttcgaagaccaaagatttgcagatt
ccggcgaacctgccgcctggtgcgctgacttcggtgttgccgttgcgcgtgtggcgggtc
gaatcgatgcggccgaacgtgactgaagcagtgcggctcgctgacggcgaaagtgctggc
gaagcagacggtttcgcccgtcactggcgtgatttcatcgacaccgatgcggcgcaatcg
ctcgacgtgcgggcccgattcgcggacggccatcccgcgtatgtacaaggcggcgcgttc
cattacctcgcgagtctgttcgacgacgcgctcacggtgcgtctttttgcgcggatcgca
caggaagcggggctcgaaacgatgccgctcggcgacagcgtgcgagtgagccgtcgcggc
gcgctgacctatgtgttcaactacggcgacgaaacgcacacgctcagcggcgtagccgac
gacgcccttgtgttcggttcgcgcgcgatcgaaccgcagggtgtggccgtctatcgatca
tga

DBGET integrated database retrieval system