KEGG   Burkholderia phytofirmans: Bphyt_4847Help
Entry
Bphyt_4847        CDS       T00765                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bpy  Burkholderia phytofirmans
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Bphyt_4847
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Bphyt_4847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(963065..966523)
Genome map
AA seq 1152 aa AA seqDB search
MNRLSSVVTAIQAHYDVVVVGSGYGGGIAASRMARAGRRVCVLERGREFMAGEFPRTPFQ
GAEEVQYNTALAHIGSPLALLEVHVNDDVNAVVGCGLGGTSLINANVALEADPRLWDDPR
WPAALRADKAGRDKGYASARAMLQPSPVPQSYPALPKLQALERSAQALGMENEFSRPEIT
VTFNDRTNAAGVEQKACVGCGDCNSGCNYDAKNSTHMNYLPDAVAHGAQIFTGTAVHSVL
RDAATGKWIVGYQLVSLGRESFGAPDLFVSADIVIVSAGTIGSTALLLRSRKQGLSVSNM
LGKHFTGNGDVLAFAYNTEPVINGVGWGAHEKGEIPPVGPTITGLIDHRETPNVRDGYVI
EEGSLAGPVGAALVGLLGAAAPLVGVDVAPRSVAEQLAYDARVATSFLRGPYHGALHHTQ
SYLVMAHDDENGEIDVDDKGQPRIVWENAGKQPIFQAVEEVLKRATVPLGGKYMRNPIST
DILGNRTVTVHPLGGCGMGEDAEHGVVDHMGRVFCGATGNAVHDGLYVMDGAVMPMSLGV
NPLLTISALTERNCELLLATHPLNAAPAEGAAVTPTLPPPPTPQAASSSLTPSSPQKIGL
HFTETMVGTYTPNVAGEAATSPMEFTLTVESEDLADMISNPQHLAQTAGTLTCPALSAQP
MTISNGTFNLFVVNESDVDERNMNYRMTLNATEGKTYFLSGKKIITRTSPINLWEQTNTL
YAEVRESAQADAPLLGKATLIITPENFLKQQRTLEVTHAPDLKTRLEWTLKFGKFFAGVL
FTEYGGVAAPLQYFDPKAEPRLKRALRAPAPQIVFFDTPDGTKLRLTRYHDPARKAARPV
LLIHGSGVSSRIYSTDLIATNMVEYLFAAGYDVWLVDLRVSIEMPSVFVPTNVDKVARED
IPSAVAKIRELTGVPEIQALGHCMGGVALTMSLLYGLEGVRSVFISQVSAHPVPGTLEKI
KAGLHIPDFMEHLGLMDVTAYTEHKSWPQNLLDEALKFYPLNHKEGCGNPICHRATFLYG
LLYEHEQLNQTLHSNLQEILGVHDVGVFKHLATMVRAHKVVDAEGKDVYLTGTDGMKGLE
GMRRPIGFIHGDKNETYLPISTQLTYEMLVKHFPEQPYERTIIPGYGHIDCIFGKNAALD
VYPIIVKYLDAH
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttatcgagcgtcgtaactgcaatccaagcgcattacgacgtggttgtggtg
ggttccggctacggcggcgggatcgccgcgagccgtatggcgcgcgccgggcgccgcgtg
tgtgtgctcgaacgtgggcgcgagttcatggccggtgaatttccccgcacgccgtttcag
ggcgccgaagaagtgcaatacaacacggcgctcgcacatatcggctcgccgctggcgttg
ctcgaagtgcatgtgaacgacgacgtaaacgcggtagtcggctgcggtctcggcggcacc
tcgctgatcaacgcgaacgtcgcgctcgaagccgatccgcgcctatgggacgacccgcgc
tggccggccgccttgcgcgccgacaaggcgggacgcgacaaagggtacgcgtccgcgcga
gcaatgctgcagccgtcgccggtgccgcagagctatccggccttgccgaaattgcaggca
cttgagagatcggcgcaggcgctcggcatggaaaacgagttctcgcgtccggagatcact
gtcaccttcaatgaccgcacgaatgccgcgggtgtcgagcagaaggcttgcgtcggttgc
ggcgactgcaattccggctgcaattacgacgccaagaattcgacgcacatgaactatctg
cccgacgccgtcgcgcacggcgcgcagattttcacgggcaccgccgtccattcggtgctg
cgcgacgcagccacgggaaaatggatcgtgggttaccagctggtgagccttggccgcgaa
agcttcggcgcgccggatctgttcgtgagcgccgatatcgtcatcgtatcggccggcacg
atcggttcgaccgcgttgctgctgcgctcgcgcaagcagggcttgagcgtctccaacatg
ctcggcaaacacttcaccggcaatggcgacgtgctcgccttcgcctacaacaccgagccg
gtgatcaacggcgtcggctggggcgcgcatgaaaaaggcgagattccgccggtcgggccg
actatcaccggcctcatcgatcatcgcgagacgccgaatgtcagagacggctacgtgatc
gaagaaggctcgctcgccggtccggtgggcgcggcgctggtcggcctgctcggcgccgcc
gcgccgctcgtaggggtggatgtcgcgccgcgctccgtcgcggaacagctcgcctacgac
gcccgcgtcgccacgagctttctgcgcggcccctatcacggcgcgctccatcacacgcaa
agctacctcgtcatggcgcacgacgacgagaacggcgagatcgacgtggacgacaaaggc
cagccgcgcatcgtgtgggagaacgccggcaagcagccgatcttccaggcggtcgaagag
gtgctcaagcgggcgaccgtgccgcttggcggcaaatacatgcgcaatccgatttccacc
gatattctcggcaatcgcaccgtcaccgtgcacccgctcggcggctgcggcatgggcgaa
gatgcggaacacggcgtggtcgatcatatgggccgcgtgttctgcggcgccacgggcaac
gcggtgcacgacggactgtatgtgatggacggcgcggttatgcccatgtcgctcggcgtc
aatccgctgctgacgatttccgcgctgaccgaacgcaattgcgagctgctgctcgccacc
cacccgctgaacgccgcgccggcggaaggcgccgccgttacgccgaccctgccgcctccg
ccgacgccgcaggccgcgtcctcgtcattgacgccctcctcgccgcaaaagatcggcctg
cacttcaccgaaacgatggtcggcacctacacgccgaacgttgcgggcgaagcggccacg
agcccgatggaattcacgctgaccgtcgaatcggaagaccttgccgacatgattagcaat
ccgcagcatctggcgcaaacggccggcacgctgacctgccccgcgctctccgcgcaaccg
atgacgatctccaacggcaccttcaatctgttcgtggtcaacgagtcggacgtggacgag
cgcaacatgaattaccgcatgacgctcaacgccaccgaaggcaagacgtactttctgagc
ggcaagaagatcatcacgcgcacttcgccgatcaatctatgggagcagaccaacacgctc
tatgcggaggtccgcgagtcggcgcaagccgatgcgccgctgctcggcaaggcgacactg
atcatcacgccggaaaatttcctcaagcagcagcgcacgctcgaagtcacccacgcgccg
gatctgaagacgcgtctcgaatggaccctgaagttcggcaagtttttcgcgggcgtgctg
ttcacagaatacggcggcgtagccgcacccttgcagtatttcgacccgaaagcggaaccg
cgtctgaagcgcgcgttgcgtgcgccggcgccgcaaatcgtcttcttcgatacgcccgac
ggcacgaagctcagactcacgcgctatcacgaccccgcgcgcaaagcggcgcgtccggtg
ctgctgattcacggctcgggcgtatcgagccgcatctactccaccgacctgatcgcgacc
aacatggtcgaatatctgttcgccgccggctacgacgtgtggctcgtggatctgcgcgtc
agcatcgaaatgccaagcgtgttcgtgccgaccaatgtcgacaaggtggcgcgcgaggac
attccgtcggcggtcgccaagatccgcgaattgaccggcgtcccggagattcaggcgctc
gggcactgcatgggcggcgtggcgctgaccatgtcgctgctgtatggactcgaaggcgtg
cgctcggtgttcatttcgcaggtgtcggcgcatccggtgccgggcacgctggagaagatc
aaggctggcctgcatattcccgacttcatggaacatctcgggctgatggacgtgaccgcg
tatacggaacacaagtcgtggccgcagaacctgctcgacgaagcgctcaagttttacccg
ctcaatcataaggaaggttgcggcaatccgatctgccatcgcgcgaccttcctgtatggc
ctgctctacgagcatgaacagttgaaccagacgcttcactcgaacctgcaggaaattctc
ggtgtgcacgacgtcggcgtattcaagcatctggccacgatggtgagagcacacaaggtg
gtcgatgccgaaggcaaggatgtctatctcaccggcaccgacggcatgaaaggactggag
ggcatgcgccggccgatcgggttcattcacggcgataaaaacgaaacctatctgccgatc
agcacgcaactcacctacgagatgctggtcaagcatttccccgagcagccctacgagcga
accatcattcccggctatggacacatcgactgcatcttcgggaagaatgccgccttggat
gtctatccgataatcgtgaagtatctggacgcgcattga

DBGET integrated database retrieval system