KEGG   Burkholderia phytofirmans: Bphyt_5002Help
Entry
Bphyt_5002        CDS       T00765                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bpy  Burkholderia phytofirmans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bphyt_5002
Enzymes [BR:bpy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Bphyt_5002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1145510..1146586
Genome map
AA seq 358 aa AA seqDB search
MSTTMSANAARPVFPFAALIGQAPLQQALLLAAIDPGLGGVLVTGPRGTAKSTAARALAE
LLPEGQLVNLPLGASEDRLIGTLDLETVLRDGSVRFSPGLLAKAHRGVLYVDEVNLLPDA
LVDALLDAAASGVNTVERDGVSHSHDASFVLIGTMNPEEGELRPQLIDRFGLMIELQNCF
EPRVRQAIVKARLAFDLDPQGFRAGYAQQQAAYVERIRVARAALPQLAFDDAVHAHVSAL
CIDAAVDGLRADLVMLRAARALAALEQAAAVTAEHVDRVAEAVLAHRRHVRESPAEGGPR
EGDAERAASSDSRSSSAEGDGPPPAAAAAADSDWGYLAPEPAATTHVKGVIPLNVKKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaacgatgagtgccaacgccgcgcggcccgtttttccctttgccgcgctgatc
ggccaggcgccgttgcagcaggcgctgctgctggccgccatcgatccgggattgggcggc
gtgctggtcaccgggccgcgtggcaccgcgaagtcgaccgcggcgcgcgcgctggctgag
ttgttgccggaagggcaactggtgaatctgccgcttggcgcgagcgaagatcgcctgatc
ggtacgctcgatctcgaaaccgtgttgcgcgacgggtcggtgcgcttctcgcccggtctg
ctcgcgaaggcgcaccgcggcgtgctgtatgtggatgaagtcaatctgctgcccgacgcg
ctcgtcgatgccttgctcgacgccgccgcgagcggcgtgaataccgttgaacgcgatggc
gtatcgcacagccacgacgcgagcttcgtgctgatcggcacgatgaatcctgaagagggc
gaactgcggccgcaattgatcgaccgcttcggcttgatgatcgagttgcagaactgtttc
gagccgcgcgtgcgtcaggcgatcgtgaaggcgcggctcgcgttcgatctcgatccgcag
ggctttcgcgcgggctatgcgcagcagcaggccgcttatgtcgagcggattcgagtggcg
cgcgcagcgctgccgcaactcgcgttcgatgacgccgtgcatgcgcatgtgagcgcgctc
tgcatcgacgccgccgtggatggtttgcgcgccgatctcgtgatgctgcgcgcggcgcgc
gcgttggcggcgcttgaacaggcggctgcggtgacggcggagcatgtcgatcgggtggct
gaggcggtgttggctcatcggcggcatgttcgcgagtcgccggccgaaggtggcccgcgt
gagggcgacgccgaacgtgcggcttcttccgatagcaggtcctcatccgcggaaggcgat
gggccgccgccggccgccgctgccgccgccgattcggattggggctatctcgcgcccgag
ccggccgcaaccacgcacgtcaagggcgtcattccacttaatgtaaaaaaacgctga

DBGET integrated database retrieval system