KEGG   Burkholderia phytofirmans: Bphyt_5061Help
Entry
Bphyt_5061        CDS       T00765                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bpy  Burkholderia phytofirmans
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphyt_5061
  Energy metabolism
   00680 Methane metabolism
    Bphyt_5061
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bphyt_5061
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Bphyt_5061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1219105..1220304
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDFPKMVDPRGRSIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEVGRDVETLKVGDLVSVPFNVACGRCPTCKAQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDHAQAMAKIRDLTCLSDILPTGYHGAV
MAGVKPGATVYIAGAGPVGMAAAASARLLGAACTIVGDMNEERLAHARKMGFQTIDLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPATVLNSLMEITRAAGAIGIP
GLYVTDDPGAADAAARKGSLSIRFGLGWAKSHSFHTGQTPVMKYNHNLMQAILWDRLPIA
DIVNVTVVSLDQAPDGYRRFDGGAPKKFVIDPHGLLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgttgtgtatctggggcagggcaaggtggaagtgcagtcgatc
gactttccgaagatggtcgatccacgtggccggtcgatcggtcacggcgtgatcctgaag
gtggtgagcaccaatatttgcggctcggatcagcacatggtgcgcggccgcacgaccgcc
gaagtcggcctcgtgctcggccatgagattaccggcgaggtgatcgaggtgggccgggac
gtggaaacgctgaaggtcggcgatctcgtttcggtaccgttcaacgtggcctgcggacgt
tgtccgacctgcaaggcacaacataccggcgtgtgtctgaacgtgaatccgtcgcgcgcg
ggtggcgcttatggttacgtggacatgggcggctggatcggcggccaagccgaatacgta
ctggtgccgtacgccgacttcaatctgctgaaattccccgaccatgcgcaggcgatggcg
aaaatccgcgacctcacgtgtctgtccgacattctgccgaccggctatcacggcgcggtg
atggcaggcgtgaagcccggcgctaccgtgtatatcgcgggcgcgggtccggtgggcatg
gcggctgccgcttcggcgcgcttgctgggcgcggcctgtacgatcgtcggcgacatgaac
gaggagcgtctcgcgcatgcgcgcaagatgggcttccagaccatcgatctgtcgaaggat
gccacgctcggcgagcagatcgagcagattctcggcaagcccgaagtggattgcgcggtc
gactgcgttggcttcgaagcgcacggccacggcagcagcggatctcacgaggaagcgccg
gccaccgtgctcaactcgctgatggaaatcacgcgggccgcgggcgcgatcggcattccg
ggcctgtacgtcacggacgatccgggtgccgccgatgccgccgcgcgcaaaggcagcctg
agcatccgcttcggtctgggctgggccaagtcgcactctttccataccggacagacgccg
gtgatgaaatacaaccacaatctcatgcaggcgatcttgtgggatcgcttgccgattgcg
gatatcgtcaacgtgaccgtggtgtcgctcgaccaggcgcccgatggttatcgccggttc
gatggcggcgcgccgaagaagtttgtgatcgatccgcacgggttgttgaaggcggcttga

DBGET integrated database retrieval system