KEGG   Burkholderia phytofirmans: Bphyt_5263Help
Entry
Bphyt_5263        CDS       T00765                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpy  Burkholderia phytofirmans
Brite
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Bphyt_5263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1443000..1443911
Genome map
AA seq 303 aa AA seqDB search
MSQPTTRPTSQPSALFFPGDDHAVLMLHGLSSSPLELRFLARFLNAEGFTTCAPLLPGYS
AGSDEAAMETWIEAAVREYDALAARFTRVSICGLSIGAALALALAQRRPQAQSLVLLSLT
LSYDGWAMPWYRFLLDWAYYTPLRKRWRYREAAPFGLRNEALRAKIARAMQRSDFSEVGP
STISLPALHEASRLASNVRALVRDIKTDCLIVHAIDDETSSPRNARFVAGHIGAAFLRTI
WLDDSYHMITSDNEREIVARETALFLRESEAAHSGDEGGKQPVVSKALARRLRQLAALGK
ERA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgaccacccggccgaccagccagccgagcgccctgttcttccccggcgac
gaccatgccgtgctgatgttgcacggcctctcgagttcgccgctcgaattgcgcttcctc
gcgcgctttctgaacgccgaaggcttcaccacctgcgcgccgttgttgcccggctatagc
gccggttccgacgaagccgcgatggaaacgtggatcgaggccgccgtgcgcgagtacgac
gcgctggccgcgcgcttcacgcgcgtgtcgatctgcggcctgtcgattggcgcggcgttg
gcgctcgcgctggcgcagcgccggccgcaggcgcagtcgctcgtgctgctttcgctcacg
ctctcgtacgacggctgggcgatgccgtggtatcgcttcctgctcgactgggcgtactac
acgccgctacgcaaacgctggcgctatcgcgaagccgcgccgttcggcctgcgcaacgaa
gcgctccgggcaaagatcgcccgcgccatgcaacgcagcgatttcagcgaagtcgggccg
tcgacgatctcgctgcctgcgctgcacgaagcgagccgcctcgcgtcgaatgtgcgcgcg
cttgtgcgcgacatcaagaccgattgcctgatcgtccatgcaatcgacgatgaaacctcg
agcccgcgtaatgcccgcttcgtcgccggacatatcggcgcggccttcttgcgcacgatc
tggctggatgattcgtatcacatgatcacgtcggacaacgagcgcgagatcgtcgcgcgc
gaaaccgcgctgtttttgcgcgaaagcgaagccgctcacagcggcgacgaaggcggcaaa
caacccgtcgtctcaaaggcgctggcgcgccgtctcaggcaacttgcggcgctcggcaag
gaacgcgcatga

DBGET integrated database retrieval system