KEGG   Burkholderia phytofirmans: Bphyt_5273Help
Entry
Bphyt_5273        CDS       T00765                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bpy  Burkholderia phytofirmans
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bpy00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:bpy00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1450148..1452541)
Genome map
AA seq 797 aa AA seqDB search
MAEATAHPTPPQTLDADTLRNMDRYWRACNYLSAGMIYLRDNPLLREPLKPEHIKNRLLG
HWGSDPGQSFLLVHLNRLIKKLDLNVIYVAGPGHGAPATLANCYLEGHYSEIYPDRSQDV
AGMERFFRQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHGYGAAFDNPDLIVAVMIGDG
EAETGPLATSWHSNKFLNPIRDGAVLPVLHLNGYKIANPTILARIPREELEALLTGYGHK
PYFVEGEDPAVMHQQMAATLEQCIGEIRAIQQHARESNDASRPRWPMIVLRSPKGWTGPK
EVDGHKVEGSWRAHQVPVLDPATNSKSLKLVENWLRSYEPETLFDEAGRLVKELRELAPE
GARRISANPHANGGVLCKTLAMPPFRDYAVAVKKPAGSYTSPTEVLGKFLRDVMRNNMTN
FRVFGPDETSSNKLTAIYEASEKTWLAQTVPSDADGGELAVDGRVMEMLSEHTLEGWFEG
YVLTGRHGLFATYEAFVHVIDSMFNQHAKWLEKAKRDLGWRQPVPSINLLITSLVWRQDH
NGFTHQDPGFLDVVTNKSPDVVRIYLPPDANCLLSVADHCLRSRDYVNVIVADKQPHLQY
LDMDAAVTHCTKGIGIWDWASTDQGVEPDVVMACAGDIPTMEALAAVQILKEQFADLKIR
FVNVVDLFRLMPEHAHPHGLSSRDFDSLFTTDKPVIFNFHSYASLVHKLTYNRTNHDNLH
VHGYHEKGNINTPLELAIINQVDRFSLAIDVIDRVPRLRGVGDHAKEWLRGQIIEHLAYA
HAEGIDKEEIRNWTWKG
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaaccgcccatcccacgccgccgcaaactttagacgccgacacgttgcgc
aacatggatcgctactggcgggcctgcaactacctctcggccggcatgatctatctgcgc
gacaatccgctgctgcgcgaaccgctgaagcccgaacacatcaagaaccgcctgctcggc
cactggggttcggacccggggcagagcttcctgctcgtgcatctgaaccggctgatcaag
aagcttgatctaaatgtgatctacgtagccggtcccggtcatggcgcaccagccacgctg
gccaattgttatctcgaaggccactactcggaaatctatcccgaccgcagtcaggacgtc
gccggcatggagcgcttcttccggcagttctcgtttccgggcggcatcggttcgcactgc
acgccggagacgccgggctcgattcacgaaggcggcgagctcggctatagcctctcgcac
ggctacggcgccgcgttcgacaatcccgatctgatcgtcgcggtgatgatcggcgacggc
gaagcggagaccggtccgctcgccacctcgtggcactcgaacaagttcctcaatccgatc
cgcgacggcgcggtgttgccggtgctgcacctgaacggctacaagatcgccaatccgacc
attctcgcgcgcattccccgcgaagaactcgaagccttgctaaccggctacggccacaaa
ccgtatttcgttgaaggcgaggatcccgccgtcatgcaccagcagatggccgcgactttg
gagcaatgcatcggcgaaatccgcgcgatccagcagcatgcgcgcgagagcaacgacgcg
tcccggccgcgctggccgatgatcgtgctgcgctcacccaaaggctggaccggtccgaag
gaagtcgacggacacaaggtggaaggctcgtggcgcgcgcaccaggtgccggtgctcgat
ccggcgaccaatagcaagagcctgaaactggtcgagaactggctgcgcagttacgagccc
gaaacactgttcgacgaagcagggcgcctcgtgaaagaactgcgcgaactcgcgcccgaa
ggcgcgcgccgcatcagcgccaatccgcatgcgaacggcggtgtgctctgcaagacgctc
gccatgccgccgtttcgcgattacgcggtggcggtgaaaaagccagccggctcgtacacg
tcgccgaccgaggtgctcggcaagttcctgcgcgacgtgatgcgcaacaacatgacgaac
ttccgcgtgttcggccccgatgagacttcgagcaacaagctgaccgcgatctatgaggcg
tcggaaaaaacctggctcgcgcaaaccgtgccgagcgacgcggacggcggcgaactcgcg
gtagacggccgcgtgatggaaatgctcagcgaacacacgctcgaaggctggttcgaaggc
tacgtgctgaccggccgccacggtctgttcgccacgtacgaagccttcgtccacgtgatc
gactccatgttcaaccagcacgccaagtggctggagaaagccaaacgcgatctcggctgg
cgccagccggtgccgtcgatcaacctgctgatcacgtcgctcgtctggcgtcaggatcac
aacggcttcacgcaccaggatcccggctttctggatgtcgtcacgaataaaagcccggac
gtggtacgtatttatctgccgccggacgcgaactgcctgctgagcgtcgccgatcattgc
ctgcgttcgcgcgattacgtcaacgtgatcgtcgccgacaagcagccgcatctgcagtat
ctcgacatggacgcggccgtcacgcattgcaccaagggcatcggtatctgggactgggcg
tcgacggaccaaggcgtcgagccggacgtggtcatggcttgcgcgggcgatatcccgacc
atggaggcgctcgccgccgtgcagatcctgaaggagcagttcgccgacctgaagatccgc
ttcgtcaatgttgtcgacctgtttcgcctgatgcccgagcatgcgcatccgcacggcctg
tccagccgcgatttcgattcgttgtttaccactgacaagccggtgattttcaacttccac
tcgtatgcgtcgctggtgcacaagctgacctataaccgcacgaaccacgacaacctgcat
gtgcacggctatcacgagaagggcaacatcaacacgccgctggagttggcgatcatcaat
caggtcgaccgtttttcgctggcgatcgacgtgatcgaccgcgtgccgaggctgcgcggc
gttggcgaccacgccaaggaatggctgcgtggccagatcatcgagcatctggcttatgcg
cacgccgagggcatcgataaggaagaaatccgcaactggacgtggaaaggctga

DBGET integrated database retrieval system