KEGG   Burkholderia phytofirmans: Bphyt_5532Help
Entry
Bphyt_5532        CDS       T00765                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bpy  Burkholderia phytofirmans
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bphyt_5532
   00330 Arginine and proline metabolism
    Bphyt_5532
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bphyt_5532
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Bphyt_5532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1740242..1741156
Genome map
AA seq 304 aa AA seqDB search
MNYASILEQIRGDLQPFLGTGKVADYIPELATVPADSFGMAIVTASGEIFRTGEADTRFS
IQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVQAETALVEFMRRLTGETSIDYDSRIAQSELQHAHRNRAMAHFMASFGNMEMP
PEVVVDAYCRQCAISMSCVELAKAALFLTNHGVAPVTGERILDTSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAACVWSPALDSNGNSAAGVLALEWLTTYTG
QSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatccatcctcgaacagatccgcggcgatctgcagccttttctgggcacc
ggcaaggtggccgattacattccggaactcgccacggtgcccgccgacagtttcggcatg
gcgatcgtcacggcgtcgggtgaaattttccgcaccggcgaggccgacacgcgcttttcc
attcagagcatttccaagctgttcgcctgcacgctcgcgttccagttgctcggcgacgca
ctgtgggaacgggtcggccgggagccctcgggcaccgcgttcaattcgctcgtccagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaacgccggcgcgctggtcgtgacc
gatgtgctgtgccgccgcttcgtgcaggccgagacggcgctggtcgaattcatgcgacgg
ctgacgggcgaaacgagcatcgactacgattcgcgcatcgctcagtcggagctgcagcac
gcccaccgcaaccgcgcgatggcgcacttcatggcgagcttcggcaacatggagatgccg
ccagaagtggtggtcgatgcttattgccgtcaatgcgcgatctcgatgagttgcgtcgag
ctggcgaaggcggcgctgttcctgaccaatcatggcgtggcgccggtcaccggcgaacgg
attctcgacacgagttcggccaagcgcctttccgcgctgatgctgacctgcggcacttac
gacgcggcgggcgatttcgtctaccgggtcggcttgccggcgaaaagcggcgtgggcggc
gggatcgtcgccgtgctgccgggcgagatggcggcatgcgtgtggtcgccggcgctggat
agcaatggcaactcggcggcgggcgtgctggcgctggagtggttgacaacttatacgggg
cagtcgattttttga

DBGET integrated database retrieval system