KEGG   Paraburkholderia phytofirmans: Bphyt_5532Help
Entry
Bphyt_5532        CDS       T00765                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00220  Arginine biosynthesis
bpy00250  Alanine, aspartate and glutamate metabolism
bpy00471  D-Glutamine and D-glutamate metabolism
bpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bphyt_5532
   00220 Arginine biosynthesis
    Bphyt_5532
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bphyt_5532
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Bphyt_5532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACD19887
JGI: Bphyt5532
UniProt: B2TG13
Position
2:1740242..1741156
Genome map
AA seq 304 aa AA seqDB search
MNYASILEQIRGDLQPFLGTGKVADYIPELATVPADSFGMAIVTASGEIFRTGEADTRFS
IQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVQAETALVEFMRRLTGETSIDYDSRIAQSELQHAHRNRAMAHFMASFGNMEMP
PEVVVDAYCRQCAISMSCVELAKAALFLTNHGVAPVTGERILDTSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAACVWSPALDSNGNSAAGVLALEWLTTYTG
QSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatccatcctcgaacagatccgcggcgatctgcagccttttctgggcacc
ggcaaggtggccgattacattccggaactcgccacggtgcccgccgacagtttcggcatg
gcgatcgtcacggcgtcgggtgaaattttccgcaccggcgaggccgacacgcgcttttcc
attcagagcatttccaagctgttcgcctgcacgctcgcgttccagttgctcggcgacgca
ctgtgggaacgggtcggccgggagccctcgggcaccgcgttcaattcgctcgtccagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaacgccggcgcgctggtcgtgacc
gatgtgctgtgccgccgcttcgtgcaggccgagacggcgctggtcgaattcatgcgacgg
ctgacgggcgaaacgagcatcgactacgattcgcgcatcgctcagtcggagctgcagcac
gcccaccgcaaccgcgcgatggcgcacttcatggcgagcttcggcaacatggagatgccg
ccagaagtggtggtcgatgcttattgccgtcaatgcgcgatctcgatgagttgcgtcgag
ctggcgaaggcggcgctgttcctgaccaatcatggcgtggcgccggtcaccggcgaacgg
attctcgacacgagttcggccaagcgcctttccgcgctgatgctgacctgcggcacttac
gacgcggcgggcgatttcgtctaccgggtcggcttgccggcgaaaagcggcgtgggcggc
gggatcgtcgccgtgctgccgggcgagatggcggcatgcgtgtggtcgccggcgctggat
agcaatggcaactcggcggcgggcgtgctggcgctggagtggttgacaacttatacgggg
cagtcgattttttga

DBGET integrated database retrieval system