KEGG   Paraburkholderia phytofirmans: Bphyt_5649Help
Entry
Bphyt_5649        CDS       T00765                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00010  Glycolysis / Gluconeogenesis
bpy00620  Pyruvate metabolism
bpy00640  Propanoate metabolism
bpy00680  Methane metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
bpy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphyt_5649
   00620 Pyruvate metabolism
    Bphyt_5649
   00640 Propanoate metabolism
    Bphyt_5649
  Energy metabolism
   00680 Methane metabolism
    Bphyt_5649
Enzymes [BR:bpy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bphyt_5649
Lipid biosynthesis proteins [BR:bpy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bphyt_5649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACD19996
JGI: Bphyt5649
UniProt: B2TFI8
Position
2:complement(1852974..1854665)
Genome map
AA seq 563 aa AA seqDB search
MTAAKAFFDARDLLLRHRTDYDRAYREFAWPPLGEFNWALDYFDVIARDNDNPALWIVDD
PATDGLRLSYAQMSERSARMANFLRGVGVGRGDRLLLMLPNRVELWDVMLAAMKLGAIVL
PATTQLSADDVRDRVQIGGANFAVVDSAELAKFDALEAPLTRLSVGAPRDGWIDLAAAYD
ASPQFTPEGITLATDPMLLYFTSGTTSKPKLVEHTHQSYPVGHLSTMYWIGLQPNDIHWN
ISSPGWAKHAWSCFFAPWNAQACVFVFNFARFVPKDTLNALVRFNITTLCAPPTVWRMLV
QEHLSDYPVKLREIVGAGEPLNPEVIERVKHAWGITIRDGYGQTETTCQIGNSPGQPVVA
GSMGRPLPGYTIELIDADDQPVTEGEISLPLAQRPLGLMTGYANNAKATAQAMRNGFYRT
SDVALRRDDGYYVYVGRADDVFKSSDYRLSPFELESVLIEHEAIGEAAVVPSADALRLSV
PKAFVTVRQGYEAGPELARAVFAFSREKLAPYKRIRRLQFSELPKTISGKIRRVELRRRE
MEREAEPARLPDEYWEEDFPDLR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcgaaggcctttttcgacgcgcgtgacctgttattgcgccatcgaaccgac
tatgaccgcgcctaccgcgaattcgcgtggccgccgctaggcgagttcaactgggcgctc
gactacttcgacgtgatcgcgcgcgataacgacaacccggcgctgtggatcgtcgacgat
ccggccaccgacggcctgcgcctgtcgtacgcgcagatgtcggagcgctcggcgcgcatg
gcgaatttcctgcgcggcgtgggcgtgggccgcggcgaccgcctgctgctgatgctgccg
aaccgcgtcgaactgtgggacgtgatgctcgcagccatgaagctcggcgcgattgtattg
cccgccaccacccagctctccgccgatgacgtgcgcgatcgcgtgcagatcggcggtgcg
aatttcgcggtggtcgatagcgcggagctggccaaattcgatgcgctcgaagcgccgctc
acgcgcctctcggtgggcgcgccgcgcgacggctggatcgacctggccgcggcctatgac
gcatcgccgcaattcacgcccgaaggcattacgctggccaccgacccgatgttgctgtac
ttcacctcaggcaccacctcgaagcccaagctggtcgaacacacgcatcaaagctatccg
gtcggccatctgtcgaccatgtactggatcggcctgcaaccgaacgacatccattggaat
atcagctcgccaggctgggccaagcacgcgtggagctgcttcttcgcgccgtggaatgcg
caggcctgcgtgttcgttttcaactttgcgcgcttcgtgccgaaagacacgctgaacgcg
ctggtgcgtttcaacatcacgacgctgtgcgcgccgccgacggtctggcgcatgctggtg
caggagcatctgagcgactatccggtcaagctgcgtgaaatcgtcggcgccggcgagccg
ttgaatcccgaggtcatcgagcgcgtgaagcacgcgtggggtattacgatccgcgacggc
tacggccagaccgagaccacctgccagatcggcaactcgccgggccagccggtcgtcgcg
ggttcgatgggacgtccgctgccgggctacacgatcgaactgatcgacgccgatgaccag
cccgtcaccgaaggcgaaatctcgctgccacttgcgcaacggccgctcggcctgatgacc
ggctacgcgaacaacgccaaggccaccgcgcaagccatgcgcaacggcttctaccgcacg
tccgacgtggcgctgcgccgtgacgacggctactacgtctatgtcggccgcgccgacgac
gtcttcaaatcgtccgattaccgcctcagtccgttcgagctagaaagcgtgctgatcgaa
cacgaggcgatcggcgaggctgccgtggtaccgagcgccgacgcgctgcgtctgtcggtg
cctaaggcgttcgtcaccgtgcgccagggttacgaagccggccccgaactcgcgcgtgcc
gtattcgcgttctcgcgcgaaaaactcgcgccgtacaagcggattcgacgcctgcaattc
agcgaattacccaagaccatctccggcaagattcgccgcgtcgaattgcgacgccgcgaa
atggagcgcgaggccgaacccgcgcgcctgcccgacgagtattgggaagaagatttcccg
gatctgcgctga

DBGET integrated database retrieval system