KEGG   Paraburkholderia phytofirmans: Bphyt_5838Help
Entry
Bphyt_5838        CDS       T00765                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bpy  Paraburkholderia phytofirmans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:2045332..2046513
Genome map
AA seq 393 aa AA seqDB search
MRVRINKKIGVALALGLAASVSFANLVKVAQTTAAPGACGDWSGYRAFVERFVQADGRVI
DYSTPAQQTTSEGQSYALFFALVANDRATFDRLLGWTRTNLAGNQFDAQNMRLPSWQWGR
KADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEAAYTQLGEALAAQIARQEMTTLPGVG
PMLLPGPQGFKSGGVTRLNPSYLPLPVLRSLAHDMPNGPWGKLADSAYKLIKTTAPQGFA
PDWAAWQNGQFVVDPKNGDTGSYDAIRVYLWAGLASPADPLAKPWLAALGGMRARVAQTG
FPPEKVSSTSGTASGEGPLSYWAALAPYFKALGDERGLGLARTHLAALDTNVPGREPVYY
DRVLGLFGTGFIDGRYRFDEAGRLVPSWRKECD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttcgaatcaacaagaaaatcggcgtggcgctggcgcttgggctagcggcgtcc
gtgagtttcgccaatctcgtcaaggtggcccagaccaccgccgcgccgggcgcctgtggc
gactggagcggctatcgcgcgttcgtcgaacgcttcgtgcaggccgacggccgcgtgatc
gactactccacgccggcgcagcaaaccacttccgaaggtcagtcgtacgcgctcttcttc
gcgctggtcgcgaacgaccgcgcgactttcgaccggctgctcggctggacccgcaccaat
ctcgcgggcaatcagttcgacgcgcagaacatgcggttgccgtcgtggcaatggggcaga
aaagccgacggctcgtatggcgtgctcgatccgaattccgcttcggactccgacttgtgg
atcgcttacgatctgctgcaagcgggccgcctgtggcatgaggcggcttacacgcagttg
ggcgaggcgctggccgcgcagatcgcgcgtcaggaaatgaccaccttgccgggcgtcggg
ccgatgctgttgcctggaccgcaaggcttcaaaagcggcggcgtgacgcgcctgaatccg
agctatctgccgctgccggtgctgcgctcgctagcgcacgacatgccgaacggcccgtgg
ggcaagctcgccgacagcgcctacaagcttatcaagaccaccgcgccgcaaggcttcgcg
cccgactgggccgcctggcaaaacggccagttcgtggtcgatccgaaaaacggcgacacc
ggcagctacgacgcgatccgcgtctatctgtgggcgggcctcgcctcgcccgccgatccg
ctcgccaaaccctggctcgcggcgctcggcggcatgcgcgcccgcgtcgcgcaaaccggc
ttcccgccggagaaggtttcatcgaccagcggcacggccagcggcgaaggaccgctcagt
tactgggctgcactcgcgccatacttcaaggcgctcggcgacgagcgcggcctcggcctc
gcgcgcacgcatctcgcggcgctcgacaccaacgtgccgggtcgcgaaccggtttattac
gatcgtgtgctggggttgttcggcacgggtttcatcgacggccgctatcgtttcgacgaa
gccggacgtctcgtgccgagctggagaaaggaatgcgactga

DBGET integrated database retrieval system