KEGG   Burkholderia phytofirmans: Bphyt_5838Help
Entry
Bphyt_5838        CDS       T00765                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bpy  Burkholderia phytofirmans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bphyt_5838
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Bphyt_5838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2045332..2046513
Genome map
AA seq 393 aa AA seqDB search
MRVRINKKIGVALALGLAASVSFANLVKVAQTTAAPGACGDWSGYRAFVERFVQADGRVI
DYSTPAQQTTSEGQSYALFFALVANDRATFDRLLGWTRTNLAGNQFDAQNMRLPSWQWGR
KADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEAAYTQLGEALAAQIARQEMTTLPGVG
PMLLPGPQGFKSGGVTRLNPSYLPLPVLRSLAHDMPNGPWGKLADSAYKLIKTTAPQGFA
PDWAAWQNGQFVVDPKNGDTGSYDAIRVYLWAGLASPADPLAKPWLAALGGMRARVAQTG
FPPEKVSSTSGTASGEGPLSYWAALAPYFKALGDERGLGLARTHLAALDTNVPGREPVYY
DRVLGLFGTGFIDGRYRFDEAGRLVPSWRKECD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttcgaatcaacaagaaaatcggcgtggcgctggcgcttgggctagcggcgtcc
gtgagtttcgccaatctcgtcaaggtggcccagaccaccgccgcgccgggcgcctgtggc
gactggagcggctatcgcgcgttcgtcgaacgcttcgtgcaggccgacggccgcgtgatc
gactactccacgccggcgcagcaaaccacttccgaaggtcagtcgtacgcgctcttcttc
gcgctggtcgcgaacgaccgcgcgactttcgaccggctgctcggctggacccgcaccaat
ctcgcgggcaatcagttcgacgcgcagaacatgcggttgccgtcgtggcaatggggcaga
aaagccgacggctcgtatggcgtgctcgatccgaattccgcttcggactccgacttgtgg
atcgcttacgatctgctgcaagcgggccgcctgtggcatgaggcggcttacacgcagttg
ggcgaggcgctggccgcgcagatcgcgcgtcaggaaatgaccaccttgccgggcgtcggg
ccgatgctgttgcctggaccgcaaggcttcaaaagcggcggcgtgacgcgcctgaatccg
agctatctgccgctgccggtgctgcgctcgctagcgcacgacatgccgaacggcccgtgg
ggcaagctcgccgacagcgcctacaagcttatcaagaccaccgcgccgcaaggcttcgcg
cccgactgggccgcctggcaaaacggccagttcgtggtcgatccgaaaaacggcgacacc
ggcagctacgacgcgatccgcgtctatctgtgggcgggcctcgcctcgcccgccgatccg
ctcgccaaaccctggctcgcggcgctcggcggcatgcgcgcccgcgtcgcgcaaaccggc
ttcccgccggagaaggtttcatcgaccagcggcacggccagcggcgaaggaccgctcagt
tactgggctgcactcgcgccatacttcaaggcgctcggcgacgagcgcggcctcggcctc
gcgcgcacgcatctcgcggcgctcgacaccaacgtgccgggtcgcgaaccggtttattac
gatcgtgtgctggggttgttcggcacgggtttcatcgacggccgctatcgtttcgacgaa
gccggacgtctcgtgccgagctggagaaaggaatgcgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system