KEGG   Paraburkholderia phytofirmans: Bphyt_6316Help
Entry
Bphyt_6316        CDS       T00765                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00010  Glycolysis / Gluconeogenesis
bpy00071  Fatty acid degradation
bpy00350  Tyrosine metabolism
bpy00625  Chloroalkane and chloroalkene degradation
bpy00626  Naphthalene degradation
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
bpy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphyt_6316
  Lipid metabolism
   00071 Fatty acid degradation
    Bphyt_6316
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bphyt_6316
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bphyt_6316
   00626 Naphthalene degradation
    Bphyt_6316
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bphyt_6316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACD20643
JGI: Bphyt6316
UniProt: B2TB47
Position
2:complement(2582248..2583234)
Genome map
AA seq 328 aa AA seqDB search
MRAMLFDGSTTFLREQELPDPVPGAGQILIDIHACGVCRTDLHLVDHELEHPKQPVIPGH
EIVGTVAGLGVGVTGFVLGDRVGVPWVGHTCGHCRYCLSARENLCDDPGFTGYTIDGGFA
ERTVADSRYCFHLPEQYSDIEAAPLLCAGLIGYRTLSMAGDAQRIGIYGFGAAAHIVAQV
ARHQQRTVYAFTRPGDHAAQQLALRLGAAWAGSSADAPPEELDAALLFAPVGALIPLALR
AVAKGGVVVCGGIHMSDIPSFPYAFLWGERRVVSVANLTRDDGLAFMRIAGETHLEIKTT
TYPLTEANQALSDLRDGRLTGAAVLAVR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgatgctattcgacggcagcacgacgtttttgcgcgagcaggagttgccggat
cccgtgcccggcgccggccagattctgatcgatattcacgcgtgcggcgtgtgccgcacc
gatcttcatctggttgaccatgagctcgagcatcccaaacaacctgtcattccaggtcac
gaaatcgtcggcacggtcgccgggctcggcgtgggcgtgacggggttcgtcctcggagac
cgggtgggcgtgccctgggttggccacacgtgcgggcattgccgctactgcctgtcggcg
cgggaaaatctttgcgacgatcccggttttaccggctacacgatagacggcggtttcgcg
gagcgcaccgttgccgacagccgctactgctttcacctgccggagcagtacagcgacatc
gaggcggcgccgctgctgtgcgccggcctgatcggctatcgcacgttgagcatggcgggc
gacgcgcagcgcatcggcatttacggtttcggcgctgcggcgcatatcgtcgcgcaggtc
gcacgtcatcaacagcgtactgtgtacgcgttcacgcgcccaggcgatcacgcggcccag
caactcgcgctgcgtctcggcgcggcgtgggcgggcagcagcgcagacgcaccgccggag
gagctcgatgcggctttgcttttcgcgccggtcggtgcactcattccgttagcattgcgg
gcggtcgcgaaaggtggcgtagtggtctgcggcggcattcacatgagcgacatcccgtcc
tttccgtacgcgtttctgtggggcgagcggcgcgtggtgtcggttgcgaatctgacccgc
gatgatgggctcgccttcatgcgcattgctggcgagacgcacctcgagatcaaaacgacg
acttatccgctgacggaggccaatcaggccttgagcgatctgcgcgatggcaggctcacg
ggcgcggcagtgctcgccgtccgttag

DBGET integrated database retrieval system