KEGG   Paraburkholderia phytofirmans: Bphyt_6362Help
Entry
Bphyt_6362        CDS       T00765                                 

Definition
(GenBank) agmatinase
  KO
K18459  guanidinopropionase [EC:3.5.3.17]
Organism
bpy  Paraburkholderia phytofirmans
Brite
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Bphyt_6362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ACD20683
JGI: Bphyt6362
UniProt: B2T8M0
Position
2:complement(2623781..2624755)
Genome map
AA seq 324 aa AA seqDB search
MKENKFAPVTGTMMPRYAGVATLMRLPHMELTNNSIKDVDIGLIGVPWDGGTTNRPGARH
GPRQVRDISTMVRNVNRSSNINPFGLCNCADLGDAPVNPVDLIDSLNRIAGFYDEVCKLG
IAPLSVGGDHLVTLPIMRGLAKDRPLGMVHFDAHTDTWNRYFGDNIYTHGTPFRRAIEEG
LLDPKRTVQIGIRGALYNDSENDWGEREGIRVIDIDEFHAMGIDAVIQEARRVVGDGPTY
VTFDVDALDPVFAPGTGTPEIGGLTTLEAQHMIRGLRGLNLVGGDVVEVSPPFDPSGNTA
LVGATLMFEILCVLAESVSQRKQR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacaaatttgccccagtcacgggcacgatgatgccccgctatgccggcgta
gctacattgatgcgattacctcacatggaactcacgaacaacagtatcaaggacgtggat
atcggcctgattggcgtgccgtgggatggcggcaccaccaaccgtcccggggcacggcac
ggaccgcgtcaggtgcgcgacatttccacaatggtgcgcaacgtcaaccggtccagcaat
atcaatcccttcgggttatgcaactgcgcggacctcggagatgcaccggtcaatcctgtt
gacctgatcgactcgctcaaccgcattgccggattttacgatgaggtatgcaagcttggc
attgcgcccttgtcggtgggcggggatcacctggtgacattacccatcatgcgcgggttg
gccaaggatcgtcctctcggcatggtgcatttcgatgcccatacggacacatggaaccga
tacttcggcgacaacatttatacccatggcacgcctttccgaagggctatcgaagaaggc
ctgctggacccgaagcgcaccgtgcagatcggcattcgcggcgcgctttacaacgacagc
gagaacgattggggcgagcgcgaaggcattcgcgtgatcgatatcgatgagtttcatgca
atgggtatcgatgcggtcattcaggaggctcgtcgggtggtgggcgacggtccgacatat
gtgacgttcgatgtcgacgcgctcgacccggtattcgctcccggcacggggactcctgag
attggagggctgacgacactggaggcgcagcacatgattcgtggcttgcgagggctgaat
ctcgtgggcggcgacgtcgtggaggtgtcgccaccgttcgacccaagcggtaatacggcg
ttggtcggcgccacactgatgttcgaaattctgtgcgttctggcagagagtgttagtcag
cgtaagcaacgttaa

DBGET integrated database retrieval system