KEGG   Paraburkholderia phytofirmans: Bphyt_6396Help
Entry
Bphyt_6396        CDS       T00765                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00620  Pyruvate metabolism
bpy00630  Glyoxylate and dicarboxylate metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01200  Carbon metabolism
Module
bpy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphyt_6396
   00630 Glyoxylate and dicarboxylate metabolism
    Bphyt_6396
Enzymes [BR:bpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphyt_6396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACD20712
JGI: Bphyt6396
UniProt: B2T8Q1
Position
2:2658495..2660669
Genome map
AA seq 724 aa AA seqDB search
MTQMNTRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAERDRL
QTELDNWHRANPGPVRDLRAYRAFLEGIGYIVPAPASVKATTDNVDTEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIPETGGAEKQKAFNPVRGAAVIAYARKFLDQAA
PLANGSHADATRYSVDGGKLVVTLKNGTSELKTPAQFIGYQGEESAPSAVLLKHNGLHFE
IQIDASDSIGRTDSAHVKDVVVEAAVSTIIDCEDSVAAVDADDKVLLYRNWLGLMTGDLT
EEVTKNGKTFTRRLNADRVYTAANGTAPVVLHGRSLLFIRNVGHLMTNPAVLTKDGHEIP
EGILDAVITTLCALHDRKHQLNSRTGSVYIVKPKMHGPAEVAFASELFARVEDLLKLPRN
TIKMGIMDEERRTSVNLLACIAEASERVAFINTGFLDRTGDEMHSAMEAGPMMRKGDMKS
SAWISAYERSNVLVGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQRELERTDYATVRDELLDGLLTIPVVAEAKWSDDEIRSEIDN
NAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVQRELVEE
TFKRMAKVVDEQNAGDPLYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKFRLEV
KKES
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactcagatgaacacgcgcggcggactgcaggtcgccgccaacctcgaccagttcgtc
gaaaccgaagccctgcccggcaccggaatcgacagcgccgcattctggtcgggtttcgac
gccctcgtgcacgagctggcgcccaagaaccgtgcgctactcgccgaacgcgaccgcctg
cagaccgagctggacaactggcatcgcgccaatccgggtccggtgcgcgatctgcgagcg
taccgagcgtttctcgaaggcatcggctatatcgtgccggcgcccgcgagcgtcaaggcc
acgaccgacaacgtggacaccgaaatcgccgaacaggccggcccgcagctcgtggtgccg
ctgtcgaatcagcgctatgcgctgaacgcggcgaacgcgcgctggggcagcctgtacgac
gcgctgtacggcaccgacgcgattcccgaaaccggcggcgccgaaaagcagaaagccttc
aatccggtgcgcggcgccgcggtgatcgcctatgcccgcaagttcctcgaccaggccgcg
ccgctcgcgaacggctcgcacgcggacgccacacgttatagcgtcgatggcggcaagctg
gtcgtcacgctgaagaacggcacgagcgagctgaagacgccggcgcaattcatcggctat
cagggcgaggaaagcgcgccgtccgcagtgctgctcaagcacaatggcctgcacttcgaa
atccagatcgacgcgagcgactccatcggcaggaccgattccgcgcacgtgaaggacgtg
gtggtcgaagcggcggtgagcacgatcatcgactgcgaagactcggtcgcggccgtggat
gcggacgacaaggtcctgctctaccgcaactggctcggtctgatgaccggcgacctgacc
gaagaggtcacgaagaacggcaagaccttcacgcgccggctgaacgccgaccgcgtgtac
accgccgcgaacggcaccgcgccggtcgtgctgcatggccgctcgctgctgttcatccgc
aacgtcggtcatttgatgaccaacccggcggtgctgacgaaagacggccacgagattccg
gaaggcattctcgacgccgtcatcaccacgctgtgcgcattgcacgaccgcaagcatcag
ttgaattcgcgcaccggctcggtctatatcgtcaagccgaagatgcacggcccggccgaa
gtcgctttcgccagcgagctgttcgcgcgcgtggaagacctgctgaagctgccgcgcaac
acgatcaagatgggcatcatggacgaggagcgccgcaccagcgtgaacctgctcgcctgt
atcgccgaagcgtcggagcgtgtcgcattcatcaacacgggtttcctcgaccgcaccggc
gacgaaatgcactcggccatggaagcgggaccgatgatgcgcaagggcgacatgaagtcg
agcgcctggatctccgcctatgagcgcagcaacgtgctggtcggtttgagcgcgggtctg
cgcggccgcgcgcagatcggcaaaggcatgtgggcgatgcccgatctgatgcacgccatg
ctcgaacagaaaatcgcgcatccgaaagccggggcgaataccgcatgggtgccctcgccg
accgccgccacgctgcacgcgttgcattaccaccaggtcgacgtgcaagcggttcagcgc
gaactggagcgcacggattacgctacggtgcgcgacgaactgctcgacggcctgctgacg
attccggtcgtcgccgaggcgaagtggagcgacgacgagatccgcagcgagatcgacaac
aacgcacagggcattctcggctacgtggtgcgctggatcgatcagggcgtgggttgctcg
aaggtgccggacattcatgacgtcggcctgatggaagatcgtgccacgctgcgtatttcc
agccagcacattgccaactggctgtatcacggcgtggtgcagcgcgaactcgtcgaagag
accttcaagcgcatggcgaaggtggtcgacgagcagaacgcgggcgacccgctctacaag
ccgatggcgccgggcttcgatacgatcgctttcaaggccgcgcaggcgctggtgttcgaa
gggcgccagcagccgagcggctatacggaaccgttgctgcacaagttccggctggaagtg
aagaaagagagttga

DBGET integrated database retrieval system