KEGG   Burkholderia phytofirmans: Bphyt_6633Help
Entry
Bphyt_6633        CDS       T00765                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bpy  Burkholderia phytofirmans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bphyt_6633
   00051 Fructose and mannose metabolism
    Bphyt_6633
Enzymes [BR:bpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Bphyt_6633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2945138..2946460)
Genome map
AA seq 440 aa AA seqDB search
MSYFEHIPEIRYEGPQSDNPLAYRHYDKSKKVLGKTLEEHLRIAVCYWHTFVWPGVDIFG
QGTFRRPWQQAGDAMERAQQKADSAFEFFSKLGTPYYTFHDTDVSPEGSNLKEYSENFLR
ITDYLARKQESTGIKLLWGTANLFSHPRYAAGAATSPDPEVFAFAATQVRHALDATQRLG
GDNYVLWGGREGYDTLLNTDLVRERDQLARFLHMVVDHAHKIGFKGSLLIEPKPQEPTKH
QYDYDVATVHGFLLQHGLDKEIRVNIEANHATLAGHSFHHEIATAYALGIFGSVDANRGD
PQNGWDTDQFPNSVEELTLAFYEILKHGGFTTGGMNFDSKVRRQSVDPEDLFYGHIGAID
NLALAVERAAVLIENDRLDQFKRQRYSGWDAEFGRKISSGDYSLSALAEEAMARGLNPQH
ASGHQELMENIVNQAIYSGR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacttcgaacacattcccgagatccgctacgaaggccctcaatcggataacccg
cttgcgtaccgtcactacgataaaagcaagaaggtgctcggcaagacactcgaagaacat
ctgcgcattgccgtgtgctattggcatacgtttgtttggccgggtgtggatattttcggg
caaggcacgtttcggcgtccctggcagcaagccggcgacgcaatggaacgggcgcagcaa
aaagcggattccgcattcgagttcttctcgaagctgggcacgccgtactacacgtttcat
gataccgacgtctcgcctgaagggtcgaacctgaaggagtacagcgaaaacttcttacgc
atcaccgactatctggcgcgcaagcaggagagcacgggtatcaagctgctgtggggcacg
gccaatctgttctcgcatccgcgttacgcggccggcgccgcgaccagtcccgatccggag
gtgttcgcgtttgcggcgacacaggtgcgccatgcgctcgatgcgacgcaacggctgggc
ggcgataactatgtgctgtggggcggccgcgaaggttacgacaccttgctcaataccgac
ctcgtgcgtgaacgcgatcaactcgcccgttttctgcatatggtcgtcgaccatgcgcac
aagatcggcttcaaaggctcgctgctgatcgaaccgaaaccgcaggagccgaccaagcat
caatacgattacgacgtcgcgaccgtgcatggattcttgctgcagcacgggctcgacaaa
gagattcgcgtgaatatcgaggccaatcacgcgacgctcgcgggccactcgtttcatcac
gagatcgccacggcttacgcgctgggtattttcggcagcgtcgatgcgaatcgcggcgat
ccgcaaaacggctgggatacggatcaattcccaaatagtgtggaagagctgacgctcgcc
ttctacgaaattctcaaacacggcggcttcacaaccggcggcatgaatttcgattcgaaa
gtgcggcgccaaagcgtcgatccggaagatcttttctacggccacatcggtgcgatcgat
aacctcgcgctcgccgtcgagcgcgcggcggtgctgatcgaaaacgaccgtctcgatcaa
ttcaaacgccagcgctactcgggctgggacgcggagttcggtcgcaagatttcctccggc
gattattcgctctctgcgctggctgaggaagcaatggcgcgcggtcttaacccgcagcac
gcaagcggccatcaggagttgatggaaaacatcgtgaatcaggcgatttatagcggacgg
tga

DBGET integrated database retrieval system