KEGG   Burkholderia phytofirmans: Bphyt_6823Help
Entry
Bphyt_6823        CDS       T00765                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpy  Burkholderia phytofirmans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bphyt_6823
Enzymes [BR:bpy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bphyt_6823
Exosome [BR:bpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphyt_6823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:3165813..3168023
Genome map
AA seq 736 aa AA seqDB search
MSEHDPAVGLQPLDIDALVEARHPDPFSQLGMHQTDAGPVVRALLPNAAHVSVIARADGA
LLGELEQLRPGLFAGRVTTAAPYRLRIDWHGVVQEIEDTYSFGPVLGDEPLGRLAGGDPY
AVLECLGAHPMEFEGVPGVRFAVWAPNARRVSVVGDFNAWDGRRHPMRLRHQAGVWELFV
PRVGPGTRYKYELLSRDGHPLPLKADPCAMQTEKPPGTASIVAHVDEIEQFPWTDHEWIQ
SRASKQTPRSPISIYEAHAESWLRVAEQGQRGLDWDELAERMIPYVKSMGFTHVEFMPIA
EHPFGGSWGYQPLGQFAPSARFGKPEQFARFVDKAHEAGLGVILDWVPAHFPNDAHGLID
FDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLVASGLAWLKRYHVDGLRVDAVASM
LYRDYSRAAGEWVPNIYGGRENLESIAFLKRLNHEVGYVPGAPGAITIAEESTAWPGVTA
RVEDGGLGFQFKWNMGWMHDTLHYMEEDPVYRQYHHHNMTFGMVYAYSERFVLPLSHDEV
VHGKGSLLGKMPGDRWQKFANLRAYFGFMWTHPGKKLLFMGGEFGQMAEFDHDTSPHWHL
LDDSNHHGVQKLVRDLNRLYSEEPALHLLDCEPGGFEWLIGDDSGNSVFAYRRTDGAGRE
VVVVCNMTPVPRVGYRIGMPRGGRWSEVLNTDAGVYGGSNMGNGGLIHTDEQSSHGWPNS
ASLTLPPLATIVLRAE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcatgatccggccgtaggcctccaaccgctagatatcgacgcgctcgttgaa
gcgcgccaccccgatcctttctcgcaactcgggatgcatcagacggacgcaggtccagtg
gtgcgcgctctgttgccgaacgccgcgcacgtcagcgtgattgcgcgcgccgacggtgcg
ctgctaggcgaactcgaacaattgcggccggggctgtttgccggccgcgtcacgactgcg
gcgccgtaccgtttgcggatcgactggcatggcgtggtgcaggaaatcgaggacacctat
tcgttcggcccggttctcggcgacgagccgcttggccggctcgccggtggcgatccgtat
gcggtgctcgaatgcctcggcgcgcatccgatggaatttgagggcgtgccgggtgtgcgc
ttcgccgtgtgggcgccgaacgcacggcgcgtttcggtggtaggcgacttcaacgcgtgg
gacggccgccgtcatccgatgcggctgcgccatcaggccggcgtgtgggaattgttcgtg
ccgcgcgtcgggccgggcacgcgctacaaatacgagctgctgtcgcgcgatggtcatccg
ctgccgttgaaagccgatccgtgcgcgatgcagacggagaagccgccaggcactgcgtcg
atcgtggcgcatgtcgacgagatcgaacagtttccgtggaccgatcacgaatggatccag
tcgcgcgccagcaagcagacgccgcgctcgccgatctcgatctacgaagcgcatgcggaa
tcctggctgcgcgtcgcggaacaaggtcagcgcggactcgattgggatgaactcgcggag
cggatgattccgtacgtgaaaagcatgggcttcacgcacgtggagttcatgccgattgcc
gagcacccgttcggcggatcgtggggttatcagccgctcgggcagtttgcgccatcggcg
cgcttcggcaagcccgaacagttcgcgagattcgtcgataaggcgcacgaagccggactc
ggcgtgattctcgattgggtgcccgcgcactttccgaacgacgcgcacggcctgatcgac
tttgacggcacgccgctctacgagcacgccgacccgcgcgaaggctatcaccaggactgg
aacacgatgatctacaacctcggccgcaacgaggtgagcgcgttcctggtcgcttcgggg
ctggcgtggctgaagcgctatcacgtcgacggtctgcgcgtggacgcggtcgcctcgatg
ctgtatcgcgactattcgcgcgcggccggcgagtgggtgccgaatatttacggcggccgc
gagaacctcgaatcgatcgcattcctcaagcgcctgaatcatgaagtcggctacgtgccg
ggcgcaccgggcgcgatcacgatcgccgaggaatcgaccgcatggccgggcgtgacggcg
cgcgtggaagacggcgggctcggtttccagttcaagtggaacatgggctggatgcacgac
acgctgcactacatggaagaagatccggtctaccgtcaataccatcaccacaacatgacg
ttcgggatggtgtacgcgtattcggagcgcttcgtgctgccgctttcgcacgacgaagtg
gtgcacggcaagggctcgctgctcggcaagatgcccggcgacaggtggcagaagttcgcc
aacctgcgcgcgtacttcggtttcatgtggacgcatccgggcaagaagctgctgttcatg
ggcggcgaattcggccagatggcggaattcgatcacgatacgtcgccgcattggcatctg
ctcgacgattcgaaccatcacggcgtgcaaaagctggtgcgcgacctgaaccggctgtac
agcgaggagcccgcgctgcatctgctcgattgcgagccaggcggcttcgaatggctgatc
ggcgacgacagcggcaacagcgtattcgcctatcggcgcaccgacggcgcgggccgcgaa
gtggtcgtggtctgcaatatgacgccggtgccgcgagtcggttaccggatcggcatgccg
cgcggcggacgctggtcggaagtgctcaatacggacgccggcgtgtacggcggctcgaac
atgggcaacggcggcctgattcataccgacgagcaatcgagccacggctggccgaattcc
gcttcgctcacgctgccgccgcttgcgacgatcgtattgcgcgcggagtaa

DBGET integrated database retrieval system