KEGG   Burkholderia phytofirmans: Bphyt_6826Help
Entry
Bphyt_6826        CDS       T00765                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpy  Burkholderia phytofirmans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bphyt_6826
Enzymes [BR:bpy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bphyt_6826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:3172413..3174623
Genome map
AA seq 736 aa AA seqDB search
MTTRRNHDTIVTLASRAGFEVEWQDAHHTTQHVPESTLAALLARMGLPCGNATEIRHSAA
ALEAELSGRKLPPLMTAEVGRGIALPIAAIKSGSHYRIELESGSIIDGRFTAPKGEEALL
APIDEAGYHTLVIHEQRITLAVAPPRCYTVADAWRTLHNDASGDDTPAPPLWGIAAQLYG
LRRTGDGGIGDYSALAQIAVESAKRGAHALAVSPTHAMFSAEPERFSPYSPSSRLWLNVT
HIDPAAVFGADAAHAALEAAQASDAWSKLERLPLIDWPNAVVLKLKVLRALYEQFCEHER
AQQTPRALEFHGFCERAGRALEDHARFEALQAAQLSQEGGNGHWRNWPEALRDPRSPEVE
AFAEANRHEVDFHLFLQWLAAKGLSHAQHVAHDAGMAVGLIADLAVGCDSAGSHAWSYRD
DMLQGVSVGAPPDLFNQAGQAWGLTTFSPRAMRTQGFSAFIDMLRAAFAHAGGIRIDHIL
GLRRLWLVPEGESARNGAYLRYPLEDLLRLIALESWRHRAIVIGEDLGTVPPGFRERLEE
HGIAGIRVLWFEGAHDGKGFKPPSDWDRNAVGTTTTHDLPTVAGWWRGSDITWRNKIGQT
MARADGRDPEEAAQEERAKDRAELWRAFQLAGVAAPDVPAPPPDSAPVDEALAFVAATPG
PLVTFPLEDLLAQVEQPNLPGSIDEHPNWRRRVSVPIDELFDDDTFCDRLLAVDRARRAA
TAPLPSANASSEPDTP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
gtgactacccgacgcaatcacgacacgatcgtcactcttgcctcgcgcgccggcttcgag
gtggagtggcaggatgcgcaccatacgacgcagcatgtgcctgaaagcacactcgccgcc
ctgctcgcgcggatgggtttgccgtgcggcaacgccacggaaatccgccacagcgccgcc
gcattggaagccgaattgtcaggccgcaaactgccgccgctgatgaccgcggaagtcgga
cgcggcatcgccttgcccattgcggcgatcaaatccggcagccactatcggatcgaactg
gaaagcggctcgatcatcgacggccggtttacggcgcccaaaggcgaagaagccctgctc
gcacccatcgacgaagccggctatcacacgctcgtaatccacgaacaacgcatcacgctg
gccgtggcgccgccgcgctgctatacggtcgccgacgcctggcgcacgttgcataacgac
gcaagcggcgacgacacgcccgcgccgccgctctggggcatcgccgcgcagttgtacggc
ttgcgccgcaccggcgacggcggcatcggcgactattcggcgctcgcgcaaatcgccgtg
gaaagcgcgaagcgtggcgcgcacgcgctcgccgtcagtccgacccatgcgatgttcagc
gcggagccggagcgcttcagtccgtactcgccgtcgtcgcgtttgtggttgaacgtcacg
cacatcgatcccgccgccgtgttcggcgcggatgcggcgcatgccgcgctcgaagctgcc
caggctagcgatgcatggtcgaaactcgaacgcttgccgctgatcgactggccgaacgcg
gtcgtgctgaagctgaaggttttgcgcgcgctatacgagcaattctgcgaacacgagcgc
gcgcaacagacgccacgcgcgctggagtttcacggcttctgcgaacgcgccgggcgcgcg
ctcgaagatcacgcgcgcttcgaagcgttgcaggcggcgcaactctcgcaagaaggtggc
aacggacattggcgcaactggcccgaggcattgcgcgatccgcgtagcccggaagtcgaa
gccttcgccgaggccaaccgtcacgaggtcgatttccatctgttcctgcaatggctggcc
gccaagggtttgtcgcatgcgcaacacgtcgcgcacgacgccggcatggccgtcggcctg
atcgccgatctcgcggtgggatgcgatagcgccggcagtcacgcatggtcgtatcgcgac
gacatgctgcagggcgtgtcggtcggcgcgcccccggacctgttcaaccaggccggtcag
gcgtggggactcaccacgttttcgccgcgtgcaatgcgcacccaaggcttctccgcattc
atcgacatgttgcgcgcggcgttcgcgcatgccggcggcatccgcatcgatcacattctc
ggcttgcggcggctgtggctcgtgccggaaggcgaaagcgcgcgtaacggcgcttatttg
cgctatccgctcgaagacctgctgcgcctgatcgcgctcgaatcgtggcggcatcgcgcg
atcgtgatcggcgaagatctcggcacggtgccaccaggctttcgcgagcggctcgaagag
cacggcatcgccggcattcgcgtgctgtggttcgagggcgcgcacgacggcaaaggattc
aagccgccgtccgactgggaccgcaatgcggtcggcaccacgaccacgcacgatctgccg
acggtcgccggctggtggcgcggcagcgacatcacctggcgcaacaagatcggccagacg
atggcgcgcgccgacggccgcgatcctgaggaagccgctcaggaagagcgcgcgaaggat
cgcgccgagttgtggcgagctttccagctagcgggcgtggccgcgcccgatgtgcccgcg
ccgccgcccgacagcgcgcccgtggacgaagcgctcgccttcgtcgccgcaacgcccggc
ccgctggtgacgtttccgctcgaggatttgctcgcgcaagtcgagcagccgaatctgccc
ggctcgatcgacgagcatccgaactggcgccgccgtgtaagcgtgccgatcgatgaactg
ttcgatgacgacacgttctgtgaccggctgctcgcggtggatcgcgcgcgccgcgccgcg
accgccccgcttccttccgccaacgcttcttcggagcctgatacgccatga

DBGET integrated database retrieval system