KEGG   Paraburkholderia phytofirmans: Bphyt_6840Help
Entry
Bphyt_6840        CDS       T00765                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00260  Glycine, serine and threonine metabolism
bpy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01130  Biosynthesis of antibiotics
bpy01230  Biosynthesis of amino acids
Module
bpy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphyt_6840
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bphyt_6840
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bphyt_6840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 PcrB His_biosynth BtpA KDGP_aldolase
Motif
Other DBs
NCBI-ProteinID: ACD21132
JGI: Bphyt6840
UniProt: B2T9N0
Position
2:complement(3189698..3190510)
Genome map
AA seq 270 aa AA seqDB search
MSRIKNTFAALSAQGKKGLIPFMTAGDPDPARTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQQSSERALAHGVSLRHVIADVKRFRETNDTTPVVLMGYANPIERMGTEAFAKAAKE
AGVDGVLVVDYPPEECANFAEQMQSAGIDPIFLLAPTSTDERIAEVGKIASGYVYYVSLK
GVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAQTARSVAEVSDAVVIGSRIVQLL
EQAAPEAAAETLTRFVAEVREALDSVATAR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcaagaacacgtttgctgcgctgtccgcccaaggtaagaaaggactcatt
ccgttcatgacggccggcgacccggaccccgcgcgtacggttgaattcatgcatgcgctc
gccgccggcggcgccgatgtgatcgaactcggcgtgccgttttccgatccgatggccgat
ggtccggtgatccagcagtcgtcggaacgcgcgttggctcatggcgtgtcgctgcgccac
gtgatcgccgacgtgaagcgcttccgcgagaccaatgacaccacgcccgtcgtgctgatg
ggctacgctaatccaatcgagcgcatgggtaccgaagccttcgcgaaggcggcgaaggaa
gctggcgtggatggtgtgctggttgtcgactacccgccggaagaatgtgctaacttcgct
gaacagatgcaatctgctggcatcgatccgattttcctgctggcgcccacgtctaccgac
gagcgtattgccgaggtgggcaagattgccagcggctacgtctattatgtgtcgttgaaa
ggcgtgaccggagcggcaaatctggacgtttccagcatcgcgagtaaaatcccggccatc
aagtcgcgcgtccccctgccggtgggcgtcggtttcggtatccgcgacgcgcaaaccgcg
cgttcggtggccgaagtgtccgatgccgtcgtgatcggcagccgtatcgtgcaattgctc
gaacaggcggcgcctgaagccgctgccgagacgctgacgcgctttgtcgccgaagtgcgc
gaggcgctggatagcgtcgcgactgcccgataa

DBGET integrated database retrieval system