KEGG   Paraburkholderia phytofirmans: Bphyt_6840Help
Entry
Bphyt_6840        CDS       T00765                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bphyt_6840
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphyt_6840
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bphyt_6840
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bphyt_6840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:complement(3189698..3190510)
Genome map
AA seq 270 aa AA seqDB search
MSRIKNTFAALSAQGKKGLIPFMTAGDPDPARTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQQSSERALAHGVSLRHVIADVKRFRETNDTTPVVLMGYANPIERMGTEAFAKAAKE
AGVDGVLVVDYPPEECANFAEQMQSAGIDPIFLLAPTSTDERIAEVGKIASGYVYYVSLK
GVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAQTARSVAEVSDAVVIGSRIVQLL
EQAAPEAAAETLTRFVAEVREALDSVATAR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcaagaacacgtttgctgcgctgtccgcccaaggtaagaaaggactcatt
ccgttcatgacggccggcgacccggaccccgcgcgtacggttgaattcatgcatgcgctc
gccgccggcggcgccgatgtgatcgaactcggcgtgccgttttccgatccgatggccgat
ggtccggtgatccagcagtcgtcggaacgcgcgttggctcatggcgtgtcgctgcgccac
gtgatcgccgacgtgaagcgcttccgcgagaccaatgacaccacgcccgtcgtgctgatg
ggctacgctaatccaatcgagcgcatgggtaccgaagccttcgcgaaggcggcgaaggaa
gctggcgtggatggtgtgctggttgtcgactacccgccggaagaatgtgctaacttcgct
gaacagatgcaatctgctggcatcgatccgattttcctgctggcgcccacgtctaccgac
gagcgtattgccgaggtgggcaagattgccagcggctacgtctattatgtgtcgttgaaa
ggcgtgaccggagcggcaaatctggacgtttccagcatcgcgagtaaaatcccggccatc
aagtcgcgcgtccccctgccggtgggcgtcggtttcggtatccgcgacgcgcaaaccgcg
cgttcggtggccgaagtgtccgatgccgtcgtgatcggcagccgtatcgtgcaattgctc
gaacaggcggcgcctgaagccgctgccgagacgctgacgcgctttgtcgccgaagtgcgc
gaggcgctggatagcgtcgcgactgcccgataa

DBGET integrated database retrieval system