KEGG   Burkholderia phytofirmans: Bphyt_6842Help
Entry
Bphyt_6842        CDS       T00765                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpy  Burkholderia phytofirmans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bphyt_6842
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphyt_6842
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bphyt_6842
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bphyt_6842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(3191478..3192671)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDERGHFGQFGGVFVAETLVHALDELRAAYDKYKQDPAFVAEYERELKYFVGRPSP
IYHAQRWSEMLGGAQIFLKREDLNHTGAHKVNNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELVGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVKLIGVEAAGDGIESGRHAASLIGGSPGVLHGNRTYLLQDENGQIIET
HSVSAGLDYPGVGPEHAWLKDSKRAEYVGITDEEALKAFHDCCRIEGIIPALESSHALAY
AAKLAPTLPKDKYLLVNLSGRGDKDMHTVAERSGIQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataacttgcctgacgaaaggggccatttcggccaatttggcggcgtgttcgtcgct
gaaacgctggtccacgcgctcgacgagttgcgtgcggcatacgacaaatataagcaagac
ccggcattcgtcgccgaatacgagcgcgaattgaagtatttcgtcggccgtccgtcgccg
atttatcacgctcagcgctggagcgaaatgctcggcggcgcgcagattttcctcaaacgc
gaagacctgaatcacacgggcgcgcacaaggtcaacaacgtgatcggccaggcgttgctt
gctaaacgcatgggcaaaccgcgcgtgatcgcggaaactggcgccggtcagcacggcgtg
gcgacggcgaccatcgccgcgcgtttcggcatggaatgcgtggtctatatgggctccgag
gacgtgcgccgccaggccgccaacgtataccgcatgaagctgctcggcgcgacagtcgtg
ccggtcgagtcgggctcgcgaaccttgaaggacgcgttgaacgaagccatgcgcgactgg
gtcaccaacgtcgagaacacgttctacatcatcggcacggtggcgggaccgcatccttac
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcaaatgccc
gaactcgtcggccgtcagccggacgcggtgattgcgtgtgttggcggtggttcgaacgca
atgggcatcttttatccgtacattgacgacacttcggtgaaactgatcggcgtcgaagca
gccggcgacggaatcgaatccggtcgccacgctgcgtcgctgatcggcggaagccccggt
gtactgcacggcaaccgcacgtacctgcttcaggacgaaaacggccagatcatcgagacg
cattcggtgtcggcgggcctggattatcccggtgtcggccccgagcacgcctggctaaaa
gacagcaaacgcgcggaatatgtcggcatcaccgacgaagaagcgcttaaagccttccac
gattgctgccgaatcgaaggcatcattccggcgttggagtccagccacgcgctggcctat
gccgcgaaactcgcgccgacgctgccgaaggacaagtaccttctggtcaatctgtcgggc
cgcggcgacaaggacatgcatacggtcgctgagcgatcgggcattcagttctga

DBGET integrated database retrieval system