KEGG   Paraburkholderia phytofirmans: Bphyt_6842Help
Entry
Bphyt_6842        CDS       T00765                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00260  Glycine, serine and threonine metabolism
bpy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01130  Biosynthesis of antibiotics
bpy01230  Biosynthesis of amino acids
Module
bpy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphyt_6842
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bphyt_6842
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bphyt_6842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACD21134
JGI: Bphyt6842
UniProt: B2T9N2
Position
2:complement(3191478..3192671)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDERGHFGQFGGVFVAETLVHALDELRAAYDKYKQDPAFVAEYERELKYFVGRPSP
IYHAQRWSEMLGGAQIFLKREDLNHTGAHKVNNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELVGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVKLIGVEAAGDGIESGRHAASLIGGSPGVLHGNRTYLLQDENGQIIET
HSVSAGLDYPGVGPEHAWLKDSKRAEYVGITDEEALKAFHDCCRIEGIIPALESSHALAY
AAKLAPTLPKDKYLLVNLSGRGDKDMHTVAERSGIQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataacttgcctgacgaaaggggccatttcggccaatttggcggcgtgttcgtcgct
gaaacgctggtccacgcgctcgacgagttgcgtgcggcatacgacaaatataagcaagac
ccggcattcgtcgccgaatacgagcgcgaattgaagtatttcgtcggccgtccgtcgccg
atttatcacgctcagcgctggagcgaaatgctcggcggcgcgcagattttcctcaaacgc
gaagacctgaatcacacgggcgcgcacaaggtcaacaacgtgatcggccaggcgttgctt
gctaaacgcatgggcaaaccgcgcgtgatcgcggaaactggcgccggtcagcacggcgtg
gcgacggcgaccatcgccgcgcgtttcggcatggaatgcgtggtctatatgggctccgag
gacgtgcgccgccaggccgccaacgtataccgcatgaagctgctcggcgcgacagtcgtg
ccggtcgagtcgggctcgcgaaccttgaaggacgcgttgaacgaagccatgcgcgactgg
gtcaccaacgtcgagaacacgttctacatcatcggcacggtggcgggaccgcatccttac
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcaaatgccc
gaactcgtcggccgtcagccggacgcggtgattgcgtgtgttggcggtggttcgaacgca
atgggcatcttttatccgtacattgacgacacttcggtgaaactgatcggcgtcgaagca
gccggcgacggaatcgaatccggtcgccacgctgcgtcgctgatcggcggaagccccggt
gtactgcacggcaaccgcacgtacctgcttcaggacgaaaacggccagatcatcgagacg
cattcggtgtcggcgggcctggattatcccggtgtcggccccgagcacgcctggctaaaa
gacagcaaacgcgcggaatatgtcggcatcaccgacgaagaagcgcttaaagccttccac
gattgctgccgaatcgaaggcatcattccggcgttggagtccagccacgcgctggcctat
gccgcgaaactcgcgccgacgctgccgaaggacaagtaccttctggtcaatctgtcgggc
cgcggcgacaaggacatgcatacggtcgctgagcgatcgggcattcagttctga

DBGET integrated database retrieval system