KEGG   Burkholderia phytofirmans: Bphyt_7040Help
Entry
Bphyt_7040        CDS       T00765                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bpy  Burkholderia phytofirmans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(3422448..3423458)
Genome map
AA seq 336 aa AA seqDB search
MTEQNRDLVLVTGASGFVGSSVARIAQQKGFRVRVLVRATSPRQNVESLDAEIVVGDMRD
EASMRNALRGVRYLLHVAADYRLWAPDPSEIERSNLEGTEATMRAALKEGVERMVYTSSV
ATLKVTSSGQSADETSPLKADQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVATGHFLALERGKIGERYILGGENL
PLQQMLADIAALTGRKAPTLSLPRWPLYPLAMGAEAVAKITKREPFVTVDGLKMSKNKMY
FSSAKAERELGYRSRPYREGLSDALDWFRQAGYLKP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaaaatcgcgatctcgtactcgtgaccggcgcctccggctttgtcggctcg
tcggtggcgcgcatcgcgcaacagaagggtttcagggtgcgcgtgctggtgcgcgccacg
agcccgcgtcagaacgtcgagtcgctggacgcggaaatcgtggtcggcgatatgcgcgac
gaagcgtcgatgcgcaacgcactgcgcggcgtgcgctatctgctgcacgtggccgccgac
tatcggctgtgggcgcctgacccgagcgagatcgagcgctcgaacctcgaaggcaccgag
gcgaccatgcgcgcggcgctgaaggaaggcgtcgagcgcatggtctacacgagcagtgtc
gccacgttgaaagtgaccagttccggccagtccgccgacgaaacctcgccgctcaaagcc
gatcaggcgatcggcgtgtacaagcgcagcaaggtgctggccgagcgcgcggtggagcgg
atgatcgccgaagacggcctgccggcggtgatcgtcaatccgtccacgccaatcggaccg
cgcgatgtcaagccgacgccgacgggacgcattatcgtggaagcggcgctcggcaagatt
ccggcgttcgtcgacacgggcctgaatctcgtgcacgtggatgacgtcgcgaccggccat
ttcctcgcgctcgaacgcggcaagatcggcgagcgttatattctcggcggcgaaaatctg
ccgcttcaacagatgctcgccgatatcgcggcgctgaccggccgcaaggcgccgacgctg
agcctgccgcgctggccgctgtatccgctggccatgggcgccgaagccgtcgccaagatc
acgaaacgcgaaccgttcgtcaccgtcgacggcttgaaaatgtcgaagaacaagatgtat
ttctcttcggcaaaagcggaacgcgagctcggttatcgctcgcggccctatcgcgagggc
ttgagcgacgcactcgactggttcagacaagctggctatctgaagccgtga

DBGET integrated database retrieval system