KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0242Help
Entry
BP1026B_I0242     CDS       T02049                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
Enzymes [BR:bpz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BP1026B_I0242 (dsbC)
Secretion system [BR:bpz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BP1026B_I0242 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:242054..242782
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEV
NLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGA
RKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKSWQS
WMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
VK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcgacgctcggc
tgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaatcgcgcctc
ggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttgtacgaggtc
aatctcggctcgcagatcgtctatagcgacgcatcgggcgattacgtgctgctcggcgag
ctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgagatcaacaag
atcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggcaacggcgcg
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctcgagacgacg
ctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctgtcgcccgat
tcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaagagctggcagtcg
tggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgaccgcgctcgac
aagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgtattcctcgcc
gacggcacgcgcctgccgggcgccgtatccgccgacgaactgaatcaggcgctcgccggc
gtcaagtga

DBGET integrated database retrieval system