KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0543Help
Entry
BP1026B_I0543     CDS       T02049                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00040  Pentose and glucuronate interconversions
bpz00052  Galactose metabolism
bpz00500  Starch and sucrose metabolism
bpz00520  Amino sugar and nucleotide sugar metabolism
bpz01100  Metabolic pathways
bpz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BP1026B_I0543
   00052 Galactose metabolism
    BP1026B_I0543
   00500 Starch and sucrose metabolism
    BP1026B_I0543
   00520 Amino sugar and nucleotide sugar metabolism
    BP1026B_I0543
Enzymes [BR:bpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BP1026B_I0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFI65208
UniProt: A0A0H3HJU0
Position
1:complement(581782..582666)
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLTLVRGIKPRHVDCFYVRQAEALGLGHAVLCAQK
LVGDSPFAVVLADDLLDGRPPVLRQMIDVFNHYHTSVIGVEQIAPQDSKSYGVIDGKRWE
DNLFKLSGIVEKPEPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLK
DEQVLAHRYDGLRFDCGSKIGYLKATVEFALRHPEVAPEFERYLSERFPELVAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcacaaaagccgtattccccgtcgccggcctcggcacccgctttttgccc
gcgacgaaagcgagtccgaaggaaatgctgccgatcgtcgacaagcccctgattcagtat
gcggtcgaggaagcgatcgccgcgggcatcaccgagatgatcttcgtcacgggccgcagc
aagcgcgccatcgaggaccatttcgacaaatcgtatgagatcgaggcggagctcgaagcc
cgcggcaaggaaaagctgctgacgctcgtgcgcggcatcaagccgcggcatgtcgattgt
ttctacgtgcgccaggccgaagcgctcgggctcggtcacgcggtgctgtgcgcgcagaag
ctcgtcggcgacagcccgttcgccgtcgtcctcgcggacgacctgctcgacgggcggccg
cccgtgctgcggcagatgatcgacgtgttcaatcactatcacacgtccgtcatcggcgtc
gagcagatcgccccgcaggattcgaagtcgtacggcgtgatcgacggcaagcgctgggaa
gacaatctcttcaagctgtcgggcatcgtcgagaagcccgagccggccgccgcgccgtcg
aatttcggcgtcgtcggccgctacgtgctcacgccgcgcatcttcgaccatctgcgcgcg
ctcaagcccggggcgggcggcgaactgcaattgaccgacgcgctgcaatcgctgttgaag
gacgagcaagtgctcgcgcatcgctacgacggcctgcgcttcgattgcggcagcaagatc
ggctatttgaaggcgacggtcgagttcgcgctgcgccacccggaagtcgcccccgaattc
gaacggtatctgagcgagcgctttccggagctcgtggccgcatga

DBGET integrated database retrieval system