KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0629Help
Entry
BP1026B_I0629     CDS       T02049                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BP1026B_I0629 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BP1026B_I0629 (pyrB)
Enzymes [BR:bpz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BP1026B_I0629 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:672445..673476
Genome map
AA seq 343 aa AA seqDB search
MTTDTSGRTGNPAAAAPAERFRYGFLKGNPQLTKNGELKHLLTIEGLPRAILNQILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVR
VFHNLDEGLRDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGTSD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacacctccggccgcaccggcaatcccgccgcggccgcgcccgccgagcgc
tttcgctatggctttctgaagggcaacccgcagctcacgaagaacggcgagctcaagcat
ctgttgacgatcgagggcctgccgcgcgcgatcctcaatcagattctcgacaccgccgag
cagttcgtcagcgtgaccgaccgcgaagtgaagaaggtgccgctcttgcgcggcaaatcg
gtattcaacctgttcttcgagaattcgacgcgcacgcgcacgacgttcgagatcgccgcg
aagcggctgtccgccgacgtgatcaacctgaacatcaacgcgtcgtcgacgagcaagggc
gagtcgctcctcgacacgatcaacaatctgtcggcgatgcacgccgatctcttcgtcgtg
cgccacgcatcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcac
gtgatcaacgcgggcgacggccgtcacgcgcacccgacgcagggccttctcgacatgtac
acgatccgccactacaagcgcgacttcacgaagctgcgcgtcgcgatcgtcggcgacatt
ctccattcgcgcgtcgcgcgctcggacattcacgcgctgacgacgctcggcgtgcccgag
gtgcgcgcgatcggcccgcgcacgctgctgccgggcgggctcgagcagatgggcgtgcgc
gtgttccacaatctcgacgaaggcctgagggacgtcgacgtgatcatcatgctgcgcctg
cagaacgagcggatgagcggcgcgctgctgccgtccgcgcaggaatatttcaagagctgg
ggcttgacgcccgagcgccttgcgctcgccgcgcccgacgcgatcgtgatgcacccgggg
ccgatgaaccgcggcgtcgagatcgattcgcaagtggccgacggcccgcaatcggtgatc
ctgaaccaggtgacgttcggcatcgcggtgcgcatggccgtgatgggcatcgtcgcgggc
acgagcgactga

DBGET integrated database retrieval system