KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0653Help
Entry
BP1026B_I0653     CDS       T02049                                 

Gene name
pgm
Definition
phosphoglucomutase/phosphomannomutase family protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_I0653 (pgm)
   00030 Pentose phosphate pathway
    BP1026B_I0653 (pgm)
   00051 Fructose and mannose metabolism
    BP1026B_I0653 (pgm)
   00052 Galactose metabolism
    BP1026B_I0653 (pgm)
   00500 Starch and sucrose metabolism
    BP1026B_I0653 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BP1026B_I0653 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BP1026B_I0653 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BP1026B_I0653 (pgm)
Enzymes [BR:bpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BP1026B_I0653 (pgm)
    5.4.2.8  phosphomannomutase
     BP1026B_I0653 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:700502..701920
Genome map
AA seq 472 aa AA seqDB search
MDDTESESMISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRL
SGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNP
PDYNGFKMVLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLAR
PLKLVVDAGNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLK
TTDAEIGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLA
QWVREKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLE
ILARAADPSALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRV
EYPDGFGLARSSNTTPVVVLRFEASSDAALARIQDDFRRALKAAKPDANLPF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacagagagtgaatcgatgatctcccaatccatcttcaaggcatacgatatt
cggggcgtgatcggcaagacgctcgacgccgacgtcgcgcgctcgatcggccgcgcattc
ggcagcgaagtgcgcgcgcagggcggcgacgcggtcgtcgtcgcgcgcgacggccggctc
tcggggcccgagctcgtcggcgcgctcgcggacgggctgcgcgcggcgggcgtcgatgtc
gtcgacgtcggcatggtgccgacgcccgtcggctacttcgcggcgagcgtgccgctcgcg
ctgtcgggcggcgagcgccgcgtcgattcgtgcatcgtcgtcacgggcagccacaatccg
cccgactacaacggtttcaagatggtcctgcgcggcgccgcgatttacggcgaccagatc
cagggcctgtacaagcgcatcgtcgacgcgcgtttcgagaccggcaacggttcgtatgag
cgatacgatgtcgccgatcaatacgttgagcgcatcgtcggcgacatcaggctcgcgcgg
ccgctgaagctcgtcgtcgatgcgggcaacggcgtcgcgggcccgctcgcgacgcgcctg
ttcaaggcgctcggctgcgaactcgtcgagctcttcaccgacatcgacggcaacttcccg
aaccaccacccggacccggcgcacccggagaacctgcaggacgtgatcgcgaagctgaag
acgaccgatgccgagatcggcttcgcgttcgacggcgacggcgaccgcctcggcgtcgtc
acgaaggacggccagatcatctatccggaccgccagctgatgctgttcgccgaggaagtg
ctgtcgcgcaacccgggcgcgcagatcatctacgacgtgaagtgcacgcgcaatctcgcg
cagtgggtgcgcgagaagggcggcgagccgctgatgtggaagacgggccactcgctcgtg
aaggcgaagctgcgcgagacgggcgcgccgctcgcgggcgagatgagcggccacgtgttc
ttcaaggatcgctggtacggcttcgacgacggcctctacacgggcgcgcgcctgctcgag
atcctcgcgcgcgcggccgatccgagcgcgctgctcaacggcttgccgaacgcggtgtcg
acgcccgagctgcaattgaagctcgacgaaggcgagaacgtgaagctgatcgacaagctg
cgcgccgacgcgaagttcgacggcgcggacgaggtcgtgacgatcgacggtctgcgcgtc
gagtatccggacggcttcggtctcgcgcgttcgtcgaacacgacgcccgtggtcgtgctg
cgcttcgaggcgagctccgacgcggcgctcgcgcggatccaggacgatttccggcgcgcg
ctgaaggcggcgaagccggacgcgaacctgccgttctga

DBGET integrated database retrieval system