KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0653Help
Entry
BP1026B_I0653     CDS       T02049                                 

Gene name
pgm
Definition
(GenBank) phosphoglucomutase/phosphomannomutase family protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00010  Glycolysis / Gluconeogenesis
bpz00030  Pentose phosphate pathway
bpz00051  Fructose and mannose metabolism
bpz00052  Galactose metabolism
bpz00230  Purine metabolism
bpz00500  Starch and sucrose metabolism
bpz00520  Amino sugar and nucleotide sugar metabolism
bpz00521  Streptomycin biosynthesis
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_I0653 (pgm)
   00030 Pentose phosphate pathway
    BP1026B_I0653 (pgm)
   00051 Fructose and mannose metabolism
    BP1026B_I0653 (pgm)
   00052 Galactose metabolism
    BP1026B_I0653 (pgm)
   00500 Starch and sucrose metabolism
    BP1026B_I0653 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BP1026B_I0653 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BP1026B_I0653 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BP1026B_I0653 (pgm)
Enzymes [BR:bpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BP1026B_I0653 (pgm)
    5.4.2.8  phosphomannomutase
     BP1026B_I0653 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFI65317
UniProt: A0A0H3HMJ3
Position
1:700502..701920
Genome map
AA seq 472 aa AA seqDB search
MDDTESESMISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRL
SGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNP
PDYNGFKMVLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLAR
PLKLVVDAGNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLK
TTDAEIGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLA
QWVREKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLE
ILARAADPSALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRV
EYPDGFGLARSSNTTPVVVLRFEASSDAALARIQDDFRRALKAAKPDANLPF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacagagagtgaatcgatgatctcccaatccatcttcaaggcatacgatatt
cggggcgtgatcggcaagacgctcgacgccgacgtcgcgcgctcgatcggccgcgcattc
ggcagcgaagtgcgcgcgcagggcggcgacgcggtcgtcgtcgcgcgcgacggccggctc
tcggggcccgagctcgtcggcgcgctcgcggacgggctgcgcgcggcgggcgtcgatgtc
gtcgacgtcggcatggtgccgacgcccgtcggctacttcgcggcgagcgtgccgctcgcg
ctgtcgggcggcgagcgccgcgtcgattcgtgcatcgtcgtcacgggcagccacaatccg
cccgactacaacggtttcaagatggtcctgcgcggcgccgcgatttacggcgaccagatc
cagggcctgtacaagcgcatcgtcgacgcgcgtttcgagaccggcaacggttcgtatgag
cgatacgatgtcgccgatcaatacgttgagcgcatcgtcggcgacatcaggctcgcgcgg
ccgctgaagctcgtcgtcgatgcgggcaacggcgtcgcgggcccgctcgcgacgcgcctg
ttcaaggcgctcggctgcgaactcgtcgagctcttcaccgacatcgacggcaacttcccg
aaccaccacccggacccggcgcacccggagaacctgcaggacgtgatcgcgaagctgaag
acgaccgatgccgagatcggcttcgcgttcgacggcgacggcgaccgcctcggcgtcgtc
acgaaggacggccagatcatctatccggaccgccagctgatgctgttcgccgaggaagtg
ctgtcgcgcaacccgggcgcgcagatcatctacgacgtgaagtgcacgcgcaatctcgcg
cagtgggtgcgcgagaagggcggcgagccgctgatgtggaagacgggccactcgctcgtg
aaggcgaagctgcgcgagacgggcgcgccgctcgcgggcgagatgagcggccacgtgttc
ttcaaggatcgctggtacggcttcgacgacggcctctacacgggcgcgcgcctgctcgag
atcctcgcgcgcgcggccgatccgagcgcgctgctcaacggcttgccgaacgcggtgtcg
acgcccgagctgcaattgaagctcgacgaaggcgagaacgtgaagctgatcgacaagctg
cgcgccgacgcgaagttcgacggcgcggacgaggtcgtgacgatcgacggtctgcgcgtc
gagtatccggacggcttcggtctcgcgcgttcgtcgaacacgacgcccgtggtcgtgctg
cgcttcgaggcgagctccgacgcggcgctcgcgcggatccaggacgatttccggcgcgcg
ctgaaggcggcgaagccggacgcgaacctgccgttctga

DBGET integrated database retrieval system