KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0671Help
Entry
BP1026B_I0671     CDS       T02049                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
Enzymes [BR:bpz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BP1026B_I0671 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD MTS Methyltransf_11 Methyltransf_23 Met_10 Methyltransf_12 Methyltransf_18 PrmA Ubie_methyltran Methyltransf_3 CMAS Cons_hypoth95 Methyltransf_32 Methyltr_RsmB-F KH_5 ADH_zinc_N Methyltransf_16 TPMT tRNA_U5-meth_tr DUF938 NodS ApbA
Motif
Other DBs
NCBI-ProteinID: AFI65335
UniProt: A0A0H3HHA8
Position
1:complement(719412..720065)
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDQDVLSLLSVVKRENFVPAAYRDLAFADVELPLPSGQKM
LFPRVEARILQELAVKKHENVLEIGAGGGYMAALLAARGQRVTTVEIDPDLAKFAEENLK
KNGVTNAEVVLGDGSRGWPAKAPYDVICVSGGLPVVPQELLEQLKVGGRLAAFVGGRPVM
KAQIITRIDDTQYRVADVFETYVDHLVNAIEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcacgtttcaacatgatcgaacagcagatccggccttgggatgta
ctggatcaggacgtcttgagcctgctgtcggtcgtcaagcgtgagaatttcgtgccggcc
gcgtatcgcgacctggcgttcgccgacgtcgagctgccgctgccgagcggccagaagatg
ctgttcccgcgcgtcgaggcccgcatcctgcaggagctcgcggtgaagaagcacgagaac
gtgctcgagatcggcgcgggcggcggctacatggcggccttgctggccgcgcgcggccag
cgcgtgacgacggtcgagatcgatccggatctcgcgaagttcgccgaagagaacctgaag
aagaacggcgtgacgaacgccgaggtcgtgctcggcgacggctcgcgcggctggcccgcg
aaggcgccgtacgacgtgatctgcgtgtcgggcggcctgcccgtcgtcccgcaggaactg
ctcgagcaactgaaggtgggcggccgcctcgcggcgttcgtcggcggccggccggtgatg
aaggcgcagatcatcacacgcatcgacgacacgcaatatcgcgtcgccgacgtattcgag
acctacgtcgatcacctcgtcaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system