KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0671Help
Entry
BP1026B_I0671     CDS       T02049                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpz  Burkholderia pseudomallei 1026b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(719412..720065)
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDQDVLSLLSVVKRENFVPAAYRDLAFADVELPLPSGQKM
LFPRVEARILQELAVKKHENVLEIGAGGGYMAALLAARGQRVTTVEIDPDLAKFAEENLK
KNGVTNAEVVLGDGSRGWPAKAPYDVICVSGGLPVVPQELLEQLKVGGRLAAFVGGRPVM
KAQIITRIDDTQYRVADVFETYVDHLVNAIEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcacgtttcaacatgatcgaacagcagatccggccttgggatgta
ctggatcaggacgtcttgagcctgctgtcggtcgtcaagcgtgagaatttcgtgccggcc
gcgtatcgcgacctggcgttcgccgacgtcgagctgccgctgccgagcggccagaagatg
ctgttcccgcgcgtcgaggcccgcatcctgcaggagctcgcggtgaagaagcacgagaac
gtgctcgagatcggcgcgggcggcggctacatggcggccttgctggccgcgcgcggccag
cgcgtgacgacggtcgagatcgatccggatctcgcgaagttcgccgaagagaacctgaag
aagaacggcgtgacgaacgccgaggtcgtgctcggcgacggctcgcgcggctggcccgcg
aaggcgccgtacgacgtgatctgcgtgtcgggcggcctgcccgtcgtcccgcaggaactg
ctcgagcaactgaaggtgggcggccgcctcgcggcgttcgtcggcggccggccggtgatg
aaggcgcagatcatcacacgcatcgacgacacgcaatatcgcgtcgccgacgtattcgag
acctacgtcgatcacctcgtcaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system