KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0834Help
Entry
BP1026B_I0834     CDS       T02049                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BP1026B_I0834
   00670 One carbon pool by folate
    BP1026B_I0834
Enzymes [BR:bpz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BP1026B_I0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(888561..889064)
Genome map
AA seq 167 aa AA seqDB search
MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRR
NIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEI
DQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgaccttgatcgtcgcgcgcgcccgcaacggcgtgatcggccgcgacaac
cgacttccgtggaaactccccgaggacctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacgcacgaatcgatcggccggccgctgccggggcgccgc
aacatcgtcgtcacgcgcgacgccgcgcgccgcttcgacggctgcgacacggtcacctcg
ctcgacgacgcgctcgcgctcgccgcgcgcgacggcgcggccgaagcgttcctgatcggc
ggcgcgcaactgtacgaggaaggcctgcgccacgcggacaagctgatcgtcaccgaaatc
gatcaggatttcgaaggcgacgcgtcgttccccgcgcccgatcccgcgcaatgggaagcc
gtgtcgcgcgacgcgcaccgcgcggcgcagcccaacgatttcacgtacgcgttcgtcgtc
tatcgccgcaggcgcgccggctga

DBGET integrated database retrieval system