KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1029Help
Entry
BP1026B_I1029     CDS       T02049                                 

Gene name
pdhB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bpz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpz00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpz00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpz00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1107435..1109081
Genome map
AA seq 548 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSQGSLIVVLEASGGAAASAPQAAAPAPAPAPAPAPAPAPQAAPAAAPAPAQAPAPAASG
EYRASHASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAP
AGGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELE
ALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADT
PNGLVVPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFT
PIINAPEVAILGLSRGQMKPVWDGKQFVPRLMLPLSLSYDHRVIDGAEAARFNAYLGALL
ADFRRIIL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtaaaggtcggcgatgcg
gtgtcgcaaggttcgctgatcgtcgtgctcgaagcatcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgcccgcccccgcgccggctccggcgcccgcgcccgcgcccgcgccg
caggccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggc
gagtaccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtc
gacgtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtcacc
gcgttcgtgaagggcgtgatgacgggacagcgcgcggcgcccggcgctgcggccgcgccc
gcgggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggc
ccgttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgc
aactgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaa
gcgctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctc
gcgttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagc
ctcgacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgacacg
ccgaacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatc
gcgaaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccag
atgcagggcggctgcttctcgatctcgtcgcttggcgggatcggcggcacgcacttcacg
ccgatcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccg
gtgtgggacggcaagcagtttgtgccgcgcctcatgctgccgctgtcgctgtcgtatgac
catcgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgctt
gccgatttccgtcgcatcattctttga

DBGET integrated database retrieval system