KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1122Help
Entry
BP1026B_I1122     CDS       T02049                                 

Definition
gp24
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BP1026B_I1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1195657..1196154
Genome map
AA seq 165 aa AA seqDB search
MAKLPKKTLAGVVGAIAAGVLAVVVPKFEGVKLAGYLDPVGIPTKCMGDTRDVIVGRTYS
EAECRQSLETQLIAHAEPVLRCTPGLKDRPYQLAAAVSFAYNVGANAYCASTTARRFNAG
DLRGACRAINEADDGRPQWVTARGRVLPGLVKRRAEERAICERGL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttgccgaagaagacgctcgccggcgtcgtcggcgcgatcgcggccggcgtg
ctggccgtggtcgtgccgaagttcgagggcgtcaagctggcgggctacctcgatccggtc
ggcattccgacgaagtgcatgggcgatacgcgcgacgtcatcgtcggcaggacatacagc
gaggccgagtgtcgccagtcgctcgaaacgcaattgatcgcgcacgctgaacccgtgctg
cgttgcacgccggggctgaaagatcgtccgtatcagctcgcggcggccgtcagctttgca
tacaacgtcggcgcgaacgcctactgcgccagcacgacggcgaggcgcttcaacgcgggc
gatctgcgcggtgcgtgccgcgcgatcaacgaggccgacgacggccgcccgcaatgggtg
acggcgcggggccgggtattgcccggtttggtgaagcggcgggcagaagagcgcgcgatc
tgcgagcgggggctgtga

DBGET integrated database retrieval system