KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1204Help
Entry
BP1026B_I1204     CDS       T02049                                 

Gene name
aceB
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP1026B_I1204 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BP1026B_I1204 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BP1026B_I1204 (aceB)
Enzymes [BR:bpz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BP1026B_I1204 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1289036..1290628)
Genome map
AA seq 530 aa AA seqDB search
MTTTLKLPQGMAITGEIKPGYEAILTPEALELVAKLHRQFEPRRRELLAARVERTQRLDA
GERPDFLAETKSIREGDWKIAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGVFDFALFLFHNAQELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEALGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRAKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDRAMAGVRADKARDAGDG
YDGGWVAHPGLVSLAMEEFVKVLGDKPNQIGKQRDDVQIEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVTAELV
REYAKVELANVKQVVGGDTAPYDRAAAIFEQMSTSENFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacgctgaagctgccgcaaggcatggcgatcacgggcgaaatcaagcccggc
tacgaagcgatcctcacgcccgaggcgctcgaactcgtcgcgaagctgcatcgccagttc
gagccgcgccgccgcgagctgctcgccgcacgcgtcgagcgcacccagcgcctcgacgcc
ggcgagcgccccgacttcctcgccgaaacgaaatcgatccgcgagggcgactggaagatc
gcgccgctgcccgcggacctgcaatgccgccgcgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggaccaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgaacagaacggcaagtcgtacaagctcaacgacaagatcgcg
acgctgatcgtgcgcccgcgcggctggcacctcgacgaaaagcacgtgacggtggacggt
cagcgcgtgtcgggcggcgtcttcgatttcgccctcttcctgttccacaacgcgcaggag
ctgatcgcgcgcggctcgggcccgtacttctatctgccgaagatggaaagccatctggag
gcgcgcctctggaacgacattttcgtcgccgcgcaggaagcgcttggcgtgccgcgcggc
acgatccgcgcgaccgtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgcgggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctcgccgatcgcgcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaacgcgcccgcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgatcgcgccatggcgggcgtgcgcgcggacaaggcgcgcgacgccggcgacggc
tatgacggcggctgggtcgcgcacccgggcctcgtgtcgctcgcgatggaggagttcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcagatcgag
ggcaagaacctgctcgatttccagccggaagcgccgatcaccgaagccgggctgcgcaac
aacatcaacgtcggcatccactacctcggctcgtggctcgcgggcaacggctgcgtgccg
atccacaacctgatggaagacgcggcgacggccgagatctcgcgctcgcaggtctggcaa
tggatccgttcgccgaagggcacgctcgacgacggccgcaaggtcacggccgagctcgtg
cgcgagtacgcgaaggtcgagctcgcgaacgtgaagcaggttgtcggcggagataccgcg
ccgtacgatcgcgctgcggcgatcttcgagcagatgtcgacgtcggagaacttcaccgag
ttcctgacgctgccgctctacgaagagatctga

DBGET integrated database retrieval system