KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1221Help
Entry
BP1026B_I1221     CDS       T02049                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bpz00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpz00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1309230..1309709
Genome map
AA seq 159 aa AA seqDB search
MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVL
GFPCNQFGKQEPGDASQIGAFCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGL
KAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgtattcattcaacgcgcaggcgctttcggggggcgaggtgccgctcgag
caataccggggcaaggtgctcctcatcgtcaacacggcgagcgagtgcggattcacgccg
cagtacgcggggctgcagcaactgtacgatcgctttcgcgaacgcgggcttgtcgtgctc
ggctttccgtgcaatcagttcggcaagcaggagccgggcgatgcgtcgcagatcggcgcg
ttctgcgagaagaattacggcgtcacgttcccgatgttcgggaagatcgatgtgaacggc
gcgaacgcgcacccgctataccggtatctgaccgaggaggcgcccggcattctcggcctg
aaggcgatcaagtggaatttcacgaagttcctcgtgaaccgggaaggcgagatcgtgaag
cgctatgcgccgtcgacgaagcccgaggatatcgccgcggacgtcgaaaagctgctttga

DBGET integrated database retrieval system