KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1346Help
Entry
BP1026B_I1346     CDS       T02049                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BP1026B_I1346
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BP1026B_I1346
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BP1026B_I1346
Lipid biosynthesis proteins [BR:bpz01004]
 Fatty acid synthase
  Component type
   BP1026B_I1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1447318..1447992)
Genome map
AA seq 224 aa AA seqDB search
MKRTVHWKAVATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRDTG
WVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALRGV
PLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFRGVYTRLSKEMRVPLVPF
LLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacagttcactggaaggccgtcgcgacgctcgccgtggtcgcgacgttcgcc
ggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggcaagccg
gtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgatacgggc
tgggtcgcgctgatgcgcgcgcgcctcgcggccgagcgaatcgattatagcgttgcgaac
gcgagcatctccggcgacacgacgagcggcggccgcgcgcggctgcccgcggtgctcgca
cggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgcggcgtg
ccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcaggcgcgc
gcgcaggtgctgctcgtcggcatgtacgtgccgtcgaactacggcccggactacacgcaa
aagttccgcggcgtctacacgaggctgtccaaggagatgcgcgtaccgctcgtgccgttc
ctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccatccgacg
caggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctgctgcgg
acgtcatcgcgctga

DBGET integrated database retrieval system